KEGG   Klebsiella pneumoniae PMK1: PMK1_02655Help
Entry
PMK1_02655        CDS       T03419                                 

Gene name
phoA
Definition
(GenBank) Alkaline phosphatase precursor
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
kpx  Klebsiella pneumoniae PMK1
Pathway
kpx00730  Thiamine metabolism
kpx00790  Folate biosynthesis
kpx01100  Metabolic pathways
kpx02020  Two-component system
Module
kpx_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kpx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PMK1_02655 (phoA)
   00790 Folate biosynthesis
    PMK1_02655 (phoA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PMK1_02655 (phoA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpx04147]
    PMK1_02655 (phoA)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kpx00537]
    PMK1_02655 (phoA)
Enzymes [BR:kpx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PMK1_02655 (phoA)
Exosome [BR:kpx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PMK1_02655 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kpx00537]
 Enzymes
  PMK1_02655 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest PT-VENN
Motif
Other DBs
NCBI-ProteinID: AIT02115
UniProt: A0A0C7KER0
LinkDB All DBs
Position
2882164..2883579
Genome map
AA seq 471 aa AA seqDB search
MKLSALFIALIPLLGSPVIHAETTAAPVLENRAAQGDITTPGGARRLTGDQTEALRASLI
NKPAKNVILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYSLDKKTGKPDY
VTDSAASATAWTTGVKTYNGALGVDIHENSHQTILELAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPTVTSEKCPSNALEKGGKGSITEQLLNARPDVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQIVTDAASLAAATEASQDKPLLGLFADGNMPVRWEGPKASYHGN
IDKPPVTCTPNPKRDASLPTLAQMTEKAIDLLSRNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQKALEFARKDGNTLVIVTADHAHASQIIPADSKAPGLTQALNTHDGAVM
VMSYGNSEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLFTTMKAALSLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattaagcgccctgtttattgccctgattcctctactgggctcgccggttattcat
gcagaaactactgctgcgccggttctggaaaatcgcgctgcgcagggagatatcaccact
cctggcggcgcgcgtcgtttaacaggcgatcaaaccgaagcgctgcgcgcctcgttaatc
aataagccagctaaaaacgttattttgctgattggcgatggcatgggtgattcggaaatt
accgctgcgcgaaactatgccgagggggcgggcggtttctttaaaggaattgatgctctg
ccgttaaccgggcagtacacgcattattcgctggataaaaaaaccgggaaaccggactac
gtgaccgactcggcggcctccgccaccgcctggaccaccggcgtgaagacttataacggc
gcgctgggcgtcgatattcatgagaattcgcatcagaccatcctcgagctggcgaaagcg
gcggggctggccaccggcaacgtttccaccgccgagctgcaggacgccacccccgcggcg
ttggtggcgcatgtgacatcgcgtaaatgctacggcccgacggttaccagcgaaaaatgc
cccagcaatgcgctggaaaaagggggcaaaggctccattaccgaacagctgctgaacgcc
cgaccggatgtcaccctgggcggcggcgcgaagacctttgccgaaacggcgacggcgggc
gagtggcagggcaaaaccctgcgcgagcaggcgcaagcgcgcggctaccagattgtgacc
gacgcggcttctcttgccgccgcgacggaagccagtcaggataaaccgctgctgggactc
tttgccgatggcaatatgccggtacgctgggaagggccgaaggcgtcttatcacggtaat
atcgataagccgccggtgacctgtacgccaaacccgaagcgtgacgcctcgttgccgacg
ctggcgcagatgacggagaaagcgattgacctgctgagtcgcaatgagaaaggtttcttc
ctgcaagtcgaaggtgcgtccatcgataagcaggaccatgcggccaatccgtgcggccag
atcggcgaaacggttgatcttgacgaagcggtgcagaaggcgctggaattcgcgcgaaaa
gacggtaataccctggtgatcgtcaccgccgaccatgcgcatgccagccagatcatcccg
gcggatagcaaagccccggggctgacccaggctctgaacacgcacgatggcgcggtgatg
gtgatgagctacggcaactctgaggaagagtcgatggagcacaccggcacccaactgcgc
attgcggcctacggtccgcatgcggctaacgtcgtcggcctgaccgatcagaccgacctg
ttcacgaccatgaaagctgccctgagtctcaaataa

DBGET integrated database retrieval system