KEGG   Klebsiella pneumoniae PMK1: PMK1_02984Help
Entry
PMK1_02984        CDS       T03419                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kpx  Klebsiella pneumoniae PMK1
Brite
KEGG Orthology (KO) [BR:kpx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PMK1_02984 (ahpF)
Enzymes [BR:kpx01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PMK1_02984 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored Thi4 K_oxygenase NAD_binding_8 FAD_binding_3 DAO Glutaredoxin FMO-like AlaDh_PNT_C NAD_binding_9 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AIT02443
UniProt: A0A097E4F1
LinkDB All DBs
Position
3236849..3238414
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLAV
RKPSFLITNPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVFMNGQE
FGQGRMTLTEIVAKVDTGAEKRAAEELNQRDAYDVLIVGSGPSGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVNDYNVDVIDSQSATKLTPAATEG
GLHQIETASGAVLKARSVIIATGAKWRNMNVPGEEQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGVVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVTGLQYRDRVSGDEHHIALAGIFVQIGLLPNTTWLEGAVERNRMGEIIIDAKCETNV
KGVFAAGDCTTVPYKQIIIAAGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccaacatgaaaacccagctcaaggcctaccttgagaagctgaccaagcct
gttgagctgattgccacgctggatgacagcgctaaatcggcagaaatcaaggaactgttg
gctgaaatcgctgaactgtcagacaaagtcacctttaaagaagacaacacgctcgcggta
cgtaagccctcgttcctgattactaacccaggttccgaccaggggccgcgttttgcgggc
tcgccgctgggccacgagtttacctcgctggtgctggcgctgctgtggaccggcggtcat
ccgtcgaaagaggcccagtcgctgctggagcagatccgcgatattgatggcgatttcgaa
ttcgaaacctactattcgctctcctgtcataactgcccggacgtggtccaggccctgaac
ctgatggcggtgctcaacccgcgcatcaaacacacggcgattgacggcgggaccttccag
aatgagatcaccgagcgtaacgtcatgggcgtgccagcggtgttcatgaacggtcaggag
tttggtcagggacggatgacgctgactgaaatcgtcgccaaagtggataccggtgcggaa
aaacgcgcagcggaagagctgaatcagcgtgacgcttacgatgtactgatcgttggctcc
ggcccgtccggcgcggcggcggcggtctactctgcacgtaaagggattcgtaccggcctg
atgggcgaacgcttcggcggtcaggtgctggataccgtggatatcgaaaactatatttcg
gtgccgaaaaccgaaggccagaagttggcaggcgcgctgaaagcgcacgtcaatgactat
aacgtcgacgtgatcgactcccagagtgcgaccaaactgacgccggcggcgacagagggc
ggcctgcatcagatcgaaaccgcctccggcgcggtgctcaaggcgcgtagcgtcatcatc
gccaccggggcgaaatggcgcaatatgaacgtgccgggcgaagaacagtatcgcaccaag
ggcgtgacctactgccctcactgcgatggtccgctgtttaagggcaaacgcgtagcggta
atcggcggcgggaactccggcgtggaagccgccattgacctggcgggcgtcgtagagcac
gtaaccctgctggagtttgccccagagatgaaagccgaccaggtgttgcaggataaagtc
cgcagcctgaagaatgtcgacatcattcttaatgcgcagaccacggaagtgaaaggcgat
ggcagcaaagtcaccggtctgcagtatcgtgaccgggtgagcggtgatgagcatcatatc
gcgctggcggggatcttcgtccagattggcctgctgcctaacaccacctggctggaaggc
gccgttgagcgcaaccgcatgggcgagatcatcatcgatgcgaagtgcgaaaccaacgtc
aaaggcgtgttcgccgcgggcgattgcaccaccgtgccgtacaaacagattattatcgcg
gcaggggaaggggcaaaagcgtcgctgagcgctttcgactacctgatccgcacgaaaacc
gcataa

DBGET integrated database retrieval system