KEGG   Klebsiella pneumoniae PMK1: PMK1_03066Help
Entry
PMK1_03066        CDS       T03419                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
kpx  Klebsiella pneumoniae PMK1
Pathway
kpx00020  Citrate cycle (TCA cycle)
kpx00190  Oxidative phosphorylation
kpx00650  Butanoate metabolism
kpx01100  Metabolic pathways
kpx01110  Biosynthesis of secondary metabolites
kpx01120  Microbial metabolism in diverse environments
kpx01130  Biosynthesis of antibiotics
kpx01200  Carbon metabolism
Module
kpx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
kpx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:kpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PMK1_03066 (sdhA)
   00650 Butanoate metabolism
    PMK1_03066 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PMK1_03066 (sdhA)
Enzymes [BR:kpx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PMK1_03066 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     PMK1_03066 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: AIT02518
UniProt: A0A081IS69
LinkDB All DBs
Position
3316433..3318199
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNS
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEKGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQ
ESIAEQGTLRDASESDIEGSLDRLNRWNNTRSGEDPVAIRKALQECMQHNFSVFREGDAM
HKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAH
SRFDFPDRDDENWLCHSLYLPESESMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgccagtcagagagtttgatgctgttgtcatcggtgccggcggcgcaggtatg
cgcgcggcgctgcaaatttcccagagcggacagacctgtgcactgctctccaaagtgttc
cctacccgttcccataccgtatccgcgcagggtggcatcaccgtcgcgctcggtaactcc
catgaagataactgggaatggcatatgtacgacactgtaaaagggtcggactatatcggc
gaccaggacgccatcgaatacatgtgtaagaccggcccggaagcgattcttgagctggag
cacatgggactgccgttctctcgtcttgacgatggccgtatttatcagcgcccgtttggc
ggccagtcgaagaacttcggcggcgaacaggcggcgcgtaccgcggcggcggctgaccgt
accggtcacgccctgctgcacactctgtatcagcagaacctgaaaaaccacaccactatc
ttctccgaatggtacgccctcgatctggtgaaaaaccaggacggcgcggtagtcggttgt
accgccctgtgcatcgagaccggcgaagtggtctactttaaagcccgcgccaccgtgctg
gcgaccggcggcgcaggccgtatctatcagtccaccaccaacgcccacatcaatacgggt
gacggcgtcgggatggccatccgcgccggcgtgccggtgcaggatatggaaatgtggcag
ttccacccgaccggtatcgccggggctggggttctggttaccgaaggttgccgcggcgaa
ggcggttacctgctgaacaaacacggcgaacgctttatggagcgttatgccccgaacgct
aaagaccttgcgggccgtgacgtggtggcgcgttccatcatgatcgaaatccgcgaaggc
cgcggctgcgacggtccgtggggcccgcacgcgaaactgaaactggatcacctcggtaaa
gaggttctggaatctcgtctgccgggtatccttgaactttcccgtacctttgcccacgtc
gatccggtgaaagagccgatcccggttatcccaacctgtcactacatgatgggcggtatc
ccgaccaaagtcaccggccaggcgttgaccgtgaatgagaagggcgaagacgtggtgatc
ccgggcctgttcgcggtaggcgaaatcgcctgcgtatcggtccacggcgccaaccgtctg
ggcggcaactcgctgctcgacctggtggtcttcggccgcgcggcgggcctgcatctgcag
gaatccattgccgagcagggcacgctgcgcgacgctagcgaatccgatatcgaaggctcg
ctggatcgcctcaaccgctggaacaacacccgctctggtgaagatccggtggcgattcgt
aaagcgctgcaggaatgtatgcagcataacttctcggtgttccgcgaaggcgatgcgatg
cacaaaggtctggagcaactgaaagtgatccgcgagcgcctgaaaaacgcccgtctcgac
gatacctccagcgagttcaacacccagcgcgttgagtgcctggagctggataacctgatg
gaaaccgcctacgcgaccgccgtatccgctaacttccgtaccgagagccgtggtgcccac
agccgcttcgacttcccggatcgtgatgatgaaaactggctgtgccattccctgtacctg
ccagagtcggaatccatgacgcgtcgtagcgtcaatatggaaccgaaactgcgtccggca
ttcccgccgaagattcgtacttactaa

DBGET integrated database retrieval system