KEGG   Klebsiella pneumoniae PMK1: PMK1_03067Help
Entry
PMK1_03067        CDS       T03419                                 

Gene name
sdhB
Definition
(GenBank) Succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
kpx  Klebsiella pneumoniae PMK1
Pathway
kpx00020  Citrate cycle (TCA cycle)
kpx00190  Oxidative phosphorylation
kpx00650  Butanoate metabolism
kpx01100  Metabolic pathways
kpx01110  Biosynthesis of secondary metabolites
kpx01120  Microbial metabolism in diverse environments
kpx01130  Biosynthesis of antibiotics
kpx01200  Carbon metabolism
Module
kpx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
kpx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:kpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PMK1_03067 (sdhB)
   00650 Butanoate metabolism
    PMK1_03067 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PMK1_03067 (sdhB)
Enzymes [BR:kpx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PMK1_03067 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     PMK1_03067 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AIT02519
UniProt: A0A0W8ASR0
LinkDB All DBs
Position
3318215..3318931
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDDAPHMQDYTLEAEEGRDMMLLDALIQLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETSERLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgagttttcaatttatcgctataacccggatgttgacgacgctccgcacatg
caggattacacccttgaagcggaagaaggtcgcgacatgatgctgctggatgcgctgatc
cagctgaaagaaaaagatccgtcgctgtcgttccgccgctcctgccgtgaaggggtctgc
gggtccgatggtctgaacatgaacgggaaaaacggtttggcgtgcatcacgccaatctcc
gcgctgaatcagccgggcaagaagattgttatccgtccgctgccaggattaccggttatc
cgtgatttggtggtggacatggggcaattctatgcacaatatgagaagattaagccttac
ttattgaataatgggcaaaatcctccggctcgcgagcatctgcagatgcctgagcagcgt
gagaaactcgacgggctgtacgagtgtattctgtgcgcctgctgttcgacctcgtgcccg
tcgttctggtggaacccggacaagttcatcggcccggctggcctgctggccgcgtatcgc
ttcctgatcgacagtcgcgataccgaaaccagcgagcgcctggacggcctgagcgatgct
ttcagcgtattccgctgtcacagcattatgaactgcgtcagtgtgtgtccgaaggggctg
aacccgacgcgcgccatcggccatattaagtcgatgctgctgcagcgcagcgcgtaa

DBGET integrated database retrieval system