KEGG   Klebsiella pneumoniae PMK1: PMK1_03484Help
Entry
PMK1_03484        CDS       T03419                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
kpx  Klebsiella pneumoniae PMK1
Pathway
kpx00020  Citrate cycle (TCA cycle)
kpx00480  Glutathione metabolism
kpx01100  Metabolic pathways
kpx01110  Biosynthesis of secondary metabolites
kpx01120  Microbial metabolism in diverse environments
kpx01130  Biosynthesis of antibiotics
kpx01200  Carbon metabolism
kpx01210  2-Oxocarboxylic acid metabolism
kpx01230  Biosynthesis of amino acids
Module
kpx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpx_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:kpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PMK1_03484 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PMK1_03484 (icd)
Enzymes [BR:kpx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PMK1_03484 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AIT02926
UniProt: F1DFL4
LinkDB All DBs
Position
3775985..3777235
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPAEGQKITLQNGKLNVPHNPIIPFIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEVYTGEKSTHVYGQDVWLPAETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSAEADKVIKFLR
DEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEGA
FKDWGYQLAREEFGGELIDGGPWVKIKNPNTGKEIVVKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMQWFEAADLIVKGMEGAIAAKTVTYDFERLMEGAKLLKCSEFGDAIIANM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagtagttccggcggaaggtcaaaaaatcaccctgcaaaacggcaaa
ctgaacgtccctcacaatccgattatcccgttcattgaaggtgacggtatcggcgttgac
gttaccccagcgatgctgaaagtggttgatgccgccgttgagaaagcctataagggcgag
cgtaaaatttcctggatggaagtttacaccggtgagaaatcaacccacgtctatggccag
gacgtctggctgccagctgaaaccctcgatctgattcgtgactaccgcgttgctatcaaa
ggtcctctgaccaccccagtcggcggcggcattcgttctctgaacgtggcgctgcgccag
gagctggatctttacgtctgcctgcgtccggtacgttactaccagggcaccccgagcccg
gttaaacacccggaactgaccgacatggttatcttccgtgaaaactcagaagatatctat
gcgggtatcgagtggaaagccgactctgcggaagcagacaaagtgatcaaattcctgcgc
gatgagatgggtgtgaagaaaattcgcttcccggaacattgcggcatcggcatcaagccg
tgctctgaagaaggcaccaaacgcctggtgcgcgccgcgattgaatacgcgatcaccaac
gatcgtgattccgtcactctggtgcacaaaggcaacatcatgaagttcaccgaaggcgcg
ttcaaagactggggctaccagctggctcgcgaagagttcggcggcgagctgatcgacggc
ggtccttgggtgaaaatcaagaacccgaacaccggcaaagagatcgtggtgaaagacgtg
atcgccgatgcgttcctgcagcagatcctgctgcgtccggcggaatacgacgttatcgcc
tgtatgaacctgaacggcgactatatctctgacgccctggcggcgcaggttggcggtatc
ggtatcgccccgggcgccaacatcggtgacgagtgcgcgctgttcgaagcgactcacggt
actgcgccgaagtatgccggccaggacaaagtgaacccgggctccatcatcctgtccgca
gagatgatgctgcgccacatgcagtggttcgaagccgcagacctgatcgttaaaggcatg
gaaggcgctatcgccgccaagaccgtgacctatgacttcgaacgtctgatggaaggcgct
aaactgctgaaatgtagcgagtttggcgacgcgattatcgcgaacatgtaa

DBGET integrated database retrieval system