KEGG   Klebsiella pneumoniae PMK1: PMK1_04378Help
Entry
PMK1_04378        CDS       T03419                                 

Gene name
xylA_4
Definition
(GenBank) Xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
kpx  Klebsiella pneumoniae PMK1
Pathway
kpx00040  Pentose and glucuronate interconversions
kpx00051  Fructose and mannose metabolism
kpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PMK1_04378 (xylA_4)
   00051 Fructose and mannose metabolism
    PMK1_04378 (xylA_4)
Enzymes [BR:kpx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     PMK1_04378 (xylA_4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AIT03817
UniProt: A0A0C7KKB1
LinkDB All DBs
Position
4699797..4700750
Genome map
AA seq 317 aa AA seqDB search
MKFSSRINSFRSRPELFDAKNKMDTCDLITRMGSAEGLTHIELNYPEHFIGQDKELIKKC
IADNGLQVGGIALRYNKDFIDGEFTNPNPALRSKAIETTLEAAEMCKFLEGNTVTLWFGY
DGYDYPFQQDYFRAYELLVDALRIVTQAHGDMQFSFEYKPYEPRTFSFIGDVSSTLMLID
DVGSDNLGITLDFCHMIMKKENPAFSLFQSARKNRLVGFHLNDGYGHFDDGLMLGSVHLL
QTLEYIYYAKRVGFSGLIYFDTFPSREDPVAECAQNIRMYKALSDFIDRLSIPEIEQMIQ
SQDALKVQGMLLKMIAE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttcctcccgaattaattctttccgttcaagacctgaactattcgatgcgaaa
aacaaaatggatacgtgtgatctcattacccgtatgggtagtgcggaaggattaacacat
atcgaacttaactatcctgagcattttattggccaggataaagaactgattaaaaaatgt
attgctgataatggtctgcaggtaggtggtattgcgctgcgctacaataaagactttatt
gatggcgagtttaccaacccgaatcctgcgttgcgcagtaaagccattgagacgacgctg
gaagccgctgagatgtgtaaatttctcgagggcaataccgtcaccttatggtttggatat
gacggctatgattacccgttccagcaagattacttccgcgcgtatgagctgctcgttgat
gccttacgcatcgtgacccaggcacatggggatatgcagttcagctttgaatacaaacct
tatgagccgcgtactttctcctttattggggatgtttcctcaaccttgatgttgattgat
gatgttggcagtgacaatctgggtatcaccctcgatttctgccatatgataatgaagaag
gaaaatccggccttctccctgttccagtcagctcgtaaaaaccgcctcgtcggtttccat
cttaatgacggctacggtcatttcgatgatggcctgatgctgggttccgtacatctcctc
cagactctggaatatatctactacgcgaaacgcgttggttttagtggcctgatttatttc
gataccttcccgagccgcgaagatccggtcgcggagtgcgctcagaatatccgtatgtac
aaagcactgtctgactttattgaccgtctcagcattcctgaaattgagcaaatgatccaa
agccaggacgccctgaaagtacagggtatgttactgaaaatgatcgccgaataa

DBGET integrated database retrieval system