KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH31: KPNIH31_05720Help
Entry
KPNIH31_05720     CDS       T03467                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
kpy  Klebsiella pneumoniae subsp. pneumoniae KPNIH31
Pathway
kpy00730  Thiamine metabolism
kpy00790  Folate biosynthesis
kpy01100  Metabolic pathways
kpy02020  Two-component system
Module
kpy_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kpy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    KPNIH31_05720
   00790 Folate biosynthesis
    KPNIH31_05720
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KPNIH31_05720
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpy04147]
    KPNIH31_05720
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kpy00537]
    KPNIH31_05720
Enzymes [BR:kpy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     KPNIH31_05720
Exosome [BR:kpy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPNIH31_05720
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kpy00537]
 Enzymes
  KPNIH31_05720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase PT-VENN Phosphodiest
Motif
Other DBs
NCBI-ProteinID: AIX83139
LinkDB All DBs
Position
1173228..1174658
Genome map
AA seq 476 aa AA seqDB search
MEMTKVKLSALFIALIPLLGSPVIHAETTAAPVLENRAAQGDITTPGGARRLTGDQTEAL
RASLINKPAKNVILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYSLDKKT
GKPDYVTDSAASATAWTTGVKTYNGALGVDIHENAHQTILELAKAAGLATGNVSTAELQD
ATPAALVAHVTSRKCYGPTVTSEKCPSNALEKGGKGSITEQLLNARPDVTLGGGAKTFAE
TATAGEWQGKTLREQAQARGYQIVTDSASLAAATEASQDKPLLGLFADGNMPVRWEGPKA
SYHGNIDKPPVTCTPNPKRDASVPTLAQMTEKAIDLLSRNEKGFFLQVEGASIDKQDHAA
NPCGQIGETVDLDEAVQKALEFARKDGNTLVIVTADHAHASQIIPADSKAPGLTQALNTH
DGAVMVMSYGNSEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLFTTMKAALSLK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggagatgacaaaagtgaaattaagcgccctgtttattgccctgattcctctactgggc
tcgccggttattcatgcagaaactactgctgcgccggttctggaaaatcgcgctgcgcag
ggagatatcaccactcctggcggcgcgcgtcgtttaacaggcgatcaaaccgaagcgctg
cgcgcctcgttaatcaataagccagctaaaaacgttattttgctgattggcgatggcatg
ggtgattcggaaattaccgctgcgcgaaactatgccgagggggcgggcggtttctttaaa
ggaattgatgctctgccgttaaccgggcagtacacgcactattcgctggataaaaaaacc
gggaaaccggactacgtgaccgactcggcggcctccgccaccgcctggaccaccggcgtg
aagacttataacggcgcgctgggcgtcgatattcatgagaatgcgcatcagaccatcctc
gagctggcgaaagcggcggggctggccaccggcaacgtttccaccgccgagctgcaggac
gccacccccgcggcgttggtagcgcatgtgacatcgcgtaaatgctacggcccgacggtc
accagcgaaaaatgccccagcaatgcgctggaaaaagggggcaaaggctccattaccgaa
cagctgctgaacgcccgaccggatgtcaccctgggcggcggcgcgaagacctttgccgaa
acggcgacggcgggcgagtggcagggcaaaaccctgcgcgagcaggcgcaagcgcgcggc
taccagattgtgaccgactcggcttctcttgccgccgcgacggaagccagtcaggataaa
ccgctgctgggactctttgccgatggcaatatgccggtacgctgggaagggccgaaggcg
tcttatcacggtaatatcgataagccgccggtgacctgtacgccaaacccgaagcgtgac
gcctcggtgccgacgctggcgcaaatgacggagaaagcgattgacctgctgagtcgcaac
gagaaaggtttcttcctgcaagtcgaaggcgcgtccatcgataagcaggaccatgcggcc
aatccgtgcggccagatcggcgaaacggttgatcttgacgaagcggtgcagaaggcgctg
gaattcgcgcgaaaagacggtaataccctggtgatcgtcaccgccgaccatgcgcatgcc
agccagatcatcccggcggatagcaaagccccggggctgacccaggctctgaacacgcac
gatggcgcggtgatggtgatgagctacggcaactctgaggaagagtcgatggagcacacc
ggcacccaactgcgcattgcggcctacggtccgcatgcggctaacgtcgtcggcctgacc
gatcagaccgacctgttcacgaccatgaaagctgccctgagtctcaaataa

DBGET integrated database retrieval system