KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH31: KPNIH31_06260Help
Entry
KPNIH31_06260     CDS       T03467                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
kpy  Klebsiella pneumoniae subsp. pneumoniae KPNIH31
Pathway
kpy00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:kpy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KPNIH31_06260
Enzymes [BR:kpy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     KPNIH31_06260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4434 Glyco_hydro_14
Motif
Other DBs
NCBI-ProteinID: AIX83243
UniProt: A0A2L0FJA5
LinkDB All DBs
Position
1280574..1282631
Genome map
AA seq 685 aa AA seqDB search
MNKFAPLHPKVSTLLHGADYNPEQWENDPDIIDKDIAMMQQAKCNVMSVGIFSWAKLEPR
EGVFNFAWLDIILDKLYAAGIHVFLATPSGARPAWMSQRYPQVLRVGRDRVPALHGGRHN
HCMSSPVYREKTLQINTLLAERYSSHPAVLGWHISNEYGGECHCDLCQNRFRDWLKARYQ
TLENLNQAWWSTFWSHTYTDWSQIESPAPQGEMSIHGLNLDWHRFNTAQVTDFCRHEIAP
LKAANASLPVTTNFMEYFYDYDYWQLAEALDFISWDSYPMWHRDKDETALACYTAMYHDM
MRSLKGGKPFVLMESTPGATNWQPTSKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRIGREVCQLGEILSKLPEVRGCRTEAKVAIIFDQQNRWALDDA
QGPRNLGMEYEKTVNEHYRPFWEQGIAVDVIDADVDLTPYQLVIAPMLYMVRDGFAGRAE
AFVANGGHLVTTYWTGIVNESDLCYLGGFPGPLRNLLGIWAEEIDCLNDGEFNLVQGLAG
NQCGLQGPYQVRHLCELIHIESAQALATYRDDFYAGRPAVTVNAFGKGKAWHVASRNDLA
FQRDFFTALSKELALPRAIATELPPGVVATARTDGDNAFIFLQNYSAQNHTLTLPQGYRD
CLTDAAVSAPLTLSAWDCRILRRHA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttgcacctttacatccgaaggttagtacgctgctgcatggcgcggattat
aatccggagcaatgggagaatgaccccgatattattgataaagacattgccatgatgcag
caggcaaaatgcaatgtgatgtcggtgggaatatttagctgggcgaaactggagccacgc
gaaggggtatttaatttcgcctggctggatattatcctcgataaactgtatgccgccggc
attcatgtctttctggccacgccgagcggcgcgcgtccggcgtggatgtcgcagcgctat
ccgcaggttctgcgggtggggcgcgatcgggtgccggccctgcacggcggccgtcacaac
cactgtatgtcgtcaccggtctatcgcgagaaaaccctgcaaatcaataccttgctggca
gaacgttattcctcacacccggcggtgctgggctggcatatttccaacgaatatggcggt
gaatgccattgcgatctctgccagaaccgttttcgcgactggctgaaggcgcgttaccag
accctggagaacctcaaccaggcctggtggagcaccttctggagtcatacctatactgac
tggtcgcagattgaatcgcctgcgccgcagggcgagatgtcgatccacggtcttaatctt
gactggcatcgctttaacaccgctcaggtgactgatttctgccgccatgaaattgctccg
ctgaaggcggcgaatgcctccctgccggtgactaccaactttatggagtatttctacgat
tacgactactggcagctggcggaggcgctggatttcatctcctgggacagctatccgatg
tggcaccgcgataaagacgaaaccgcgctggcctgttacaccgcgatgtatcacgacatg
atgcgcagcctgaagggcggcaaaccgtttgtgctgatggagtccaccccgggcgccacc
aactggcagccgaccagcaaactgaagaagccgggaatgcatattctttcctcgctgcag
gcggtggcgcatggcgccgactcggtgcagtatttccagtggcggaaaagccgcggttcg
gttgagaaatttcacggcgcagtggtcgaccacgtcggacatattgatacccgcattggc
cgcgaagtctgccagctcggcgagatcctcagcaagctgccggaggtgaggggctgtcgc
accgaggcgaaagtagcgattatcttcgaccagcagaaccgctgggcgctggatgacgcc
caggggccgcgcaatcttgggatggaatatgagaagacggtcaacgagcactaccgcccg
ttctgggagcagggcatcgccgtcgatgtgattgacgccgatgtcgatttaacgccgtat
cagttagtgattgccccgatgttatatatggtgcgcgacggctttgccggtcgggcggag
gcgtttgtcgccaacggcggccacctggtgaccacctactggaccggtatcgtcaatgag
tccgatctctgctatctcggcggcttcccgggcccgctgcgcaatctgctggggatctgg
gcggaagagatcgactgcctgaatgacggcgagtttaatctcgtgcaggggcttgccggg
aatcagtgcggtctgcagggcccttatcaggtgcgccatctctgcgaactgatccatatc
gagagcgcccaggcgctggccacctaccgggatgatttttatgccggacggccggctgtg
acggtgaacgcgttcgggaaaggcaaagcctggcatgtggcctcccgcaacgatttagcc
ttccagcgcgatttctttaccgccctgagcaaggagctggccctgccgcgggcgatagcg
acggagttaccacccggcgtggtggcgactgcgcgcaccgacggtgacaacgcatttatc
ttcctgcagaactacagcgcgcaaaaccataccctgaccctgccgcaagggtatcgggat
tgcctgaccgacgcggcggtatcggctccactgaccctgtcggcatgggattgccgtatt
ctccgtcgtcacgcgtaa

DBGET integrated database retrieval system