KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH31: KPNIH31_07930Help
Entry
KPNIH31_07930     CDS       T03467                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
kpy  Klebsiella pneumoniae subsp. pneumoniae KPNIH31
Pathway
kpy00020  Citrate cycle (TCA cycle)
kpy00190  Oxidative phosphorylation
kpy00650  Butanoate metabolism
kpy01100  Metabolic pathways
kpy01110  Biosynthesis of secondary metabolites
kpy01120  Microbial metabolism in diverse environments
kpy01130  Biosynthesis of antibiotics
kpy01200  Carbon metabolism
Module
kpy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
kpy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:kpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KPNIH31_07930 (sdhA)
   00650 Butanoate metabolism
    KPNIH31_07930 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    KPNIH31_07930 (sdhA)
Enzymes [BR:kpy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     KPNIH31_07930 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     KPNIH31_07930 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: AIX83550
UniProt: A0A1Y0Q3E8
LinkDB All DBs
Position
1628724..1630490
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNS
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEKGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQ
ESIAEQGTLRDASESDIEGSLDRLNRWNNTRSGEDPVAIRKALQECMQHNFSVFREGDAM
HKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAH
SRFDFPDRDDENWLCHSLYLPESESMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgccagtcagagagtttgatgctgttgtcatcggtgccggcggcgcaggtatg
cgcgcggcgctgcaaatttcccagagcggacagacctgtgcactgctctccaaagtgttc
cctacccgttcccataccgtatccgcgcagggtggcatcaccgtcgcgctcggtaactcc
catgaagataactgggaatggcatatgtacgacaccgtaaaagggtcggactatatcggc
gaccaggacgccatcgaatacatgtgtaagaccggcccggaagcgattcttgagctggag
cacatgggactgccgttctctcgtcttgacgatggccgtatttatcagcgcccgtttggc
ggccagtcgaagaacttcggcggcgaacaggcggcgcgtaccgcggcggcggctgaccgt
accggtcacgccctgctgcacactctgtatcagcagaacctgaaaaaccacaccactatc
ttctccgaatggtacgccctcgatctggtgaaaaaccaggacggcgcggtagtcggttgt
accgccctgtgcatcgagaccggcgaagtggtctactttaaagcccgcgccaccgtgctg
gcgaccggcggcgcaggccgtatctatcagtccaccaccaacgcccacatcaatacgggt
gacggcgtcgggatggccatccgcgccggcgtgccggtgcaggatatggaaatgtggcag
ttccacccgaccggtatcgccggggctggggttctggttaccgaaggttgccgcggcgaa
ggcggttacctgctgaacaaacacggcgaacgctttatggagcgttatgccccgaacgct
aaagaccttgcgggccgtgacgtggtggcgcgttccatcatgatcgaaatccgcgaaggc
cgcggctgcgacggtccgtggggcccgcacgcgaaactgaaactggatcacctcggtaaa
gaggttctggaatctcgtctgccgggtatccttgagctttcccgtacctttgcccacgtc
gatccggtgaaagagccgatcccggttatcccaacctgtcactacatgatgggcggtatc
ccgaccaaagtcaccggccaggcgttgaccgtgaatgagaagggcgaagacgtggtgatc
ccgggcctgttcgcggtaggcgaaatcgcctgcgtatcggtccacggcgccaaccgtctg
ggcggcaactcgctgctcgacctggtggtcttcggccgcgcggcgggcctgcatctgcag
gaatccattgccgagcagggcacgctgcgcgacgctagcgaatccgatatcgaaggctcg
ctggatcgcctcaaccgctggaacaacacccgctctggtgaagatccggtggcgattcgt
aaagcgctgcaggaatgtatgcagcataacttctcggtgttccgcgaaggcgatgcgatg
cacaaaggtctggagcaactgaaagtgatccgcgagcgcctgaaaaacgcccgtctcgac
gatacctccagcgagttcaacacccagcgcgttgagtgcctggagctggataacctgatg
gaaaccgcctacgcgaccgccgtatccgctaacttccgtaccgagagccgtggcgcccac
agccgcttcgacttcccggatcgtgatgatgaaaactggctgtgccattccctgtacctg
ccagagtcggaatccatgacgcgtcgtagcgtcaatatggaaccgaaactgcgtccggca
ttcccgccgaagattcgtacttactaa

DBGET integrated database retrieval system