KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH31: KPNIH31_07935Help
Entry
KPNIH31_07935     CDS       T03467                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
kpy  Klebsiella pneumoniae subsp. pneumoniae KPNIH31
Pathway
kpy00020  Citrate cycle (TCA cycle)
kpy00190  Oxidative phosphorylation
kpy00650  Butanoate metabolism
kpy01100  Metabolic pathways
kpy01110  Biosynthesis of secondary metabolites
kpy01120  Microbial metabolism in diverse environments
kpy01130  Biosynthesis of antibiotics
kpy01200  Carbon metabolism
Module
kpy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
kpy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:kpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KPNIH31_07935 (sdhB)
   00650 Butanoate metabolism
    KPNIH31_07935 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    KPNIH31_07935 (sdhB)
Enzymes [BR:kpy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     KPNIH31_07935 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     KPNIH31_07935 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AIX83551
UniProt: A0A2W0M0M9
LinkDB All DBs
Position
1630506..1631222
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDDAPHMQDYTLEAEEGRDMMLLDALIQLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETSERLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgagttttcaatttatcgctataacccggatgttgacgacgctccgcacatg
caggattacacccttgaagcggaagaaggtcgcgacatgatgctgctggatgcgctgatc
cagctgaaagaaaaagatccgtcgctgtcgttccgccgctcctgccgtgaaggggtctgc
gggtccgatggtctgaacatgaacgggaaaaacggtttggcgtgcatcacgccaatctcc
gcgctgaatcagccgggcaagaagattgttatccgtccgctgccaggattaccggttatc
cgtgatttggtggtggacatggggcaattctatgcacaatatgagaagattaagccttac
ttgttgaataatgggcaaaatcctccggctcgcgagcatctgcagatgcctgagcagcgt
gagaaactcgacgggctgtacgagtgtattctgtgcgcctgctgttcgacctcgtgcccg
tcgttctggtggaacccggacaagttcatcggcccggctggcctgctggccgcgtatcgc
ttcctgatcgacagtcgcgataccgaaaccagcgagcgcctggacggcctgagcgatgct
ttcagcgtattccgctgtcacagcattatgaactgcgtcagtgtgtgtccgaaggggctg
aacccgactcgcgccatcggccatattaagtcgatgctgctgcagcgcagcgcgtaa

DBGET integrated database retrieval system