KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH31: KPNIH31_17010Help
Entry
KPNIH31_17010     CDS       T03467                                 

Definition
(GenBank) tyrosine protein kinase
  KO
K16692  tyrosine-protein kinase Etk/Wzc [EC:2.7.10.-]
Organism
kpy  Klebsiella pneumoniae subsp. pneumoniae KPNIH31
Brite
Enzymes [BR:kpy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.-  
     KPNIH31_17010
Protein kinases [BR:kpy01001]
 Non-receptor tyrosine kinases
  Bacterial
   KPNIH31_17010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GNVR Wzz AAA_31 CbiA AAA_26 LMBR1 ParA Wtap Fer4_NifH AAA_25 T2SSM Occludin_ELL BRE1
Motif
Other DBs
NCBI-ProteinID: AIX85232
UniProt: A0A2P5UND7
LinkDB All DBs
Position
complement(3421596..3423761)
Genome map
AA seq 721 aa AA seqDB search
MSSIKSNKPINDSDELDLGRVIGEIFDHRKLIIAVTSLFTLIALIYALLATPIYQADALI
QVEQKQGNAILSSLSQVFPDSQPQSAPEITLLQSRMILGKTVDDLNLQVKVEELFFPVIG
QGLARLFNKTKNTIQVHKLFISPNMYDDNFITLTVKNDHQYSISGENIDFDGEIGRLIDK
NGIRIQVDSINAEPGTRFLLTYTSRINAINYLRDSLLIADQGKDTGMLTISLLGSDPDLI
KRVIDSISDNYLEQNIARQAAQDAKSLDFLNQQLPKVRTELNESEDKLNAYRRQKDSVDL
SLEAKSVLDQIVNVDNQLNELTFKESEISQLYTQEHPTYKALMEKRKILQDERAKLNKRV
STMPETQQEVLRLSRDVESGRAVYMQLLNRQQELNIAKSSAIGNVRIIDNAVTQPKPVKP
KKLIIIAIGLISGFAISLGVVFLRTFLRRGIESPEQLEDLGITVYASIPVAEVLSNRAKQ
PSKIRFKKEEDANYTYLATSHPTDLAIEAIRGLRTSLHFAMMEARNNILMISGASPNAGK
TFVSSNLGGVIAQTGKKILFIDADLRKGYTHKIFNESNENGLSEYLSGKIKLEDTIKHLG
SEGFDFISRGMAPPNPAELLMHRRFGELIKWVSQAYDMVIIDTPPILAVTDAAIIGNYVG
TTLLVARFEQNTTKELEVSVKRFEQSGVAIKGCILNGVVKKASSYYGYGYAHYGYSYKDE
K
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaataaaaagtaacaaacctattaatgattcagatgaactagatctggggcgt
gttatcggtgaaatattcgaccatagaaaattaataatcgcggtaacctcactatttacg
cttatcgcgcttatatatgccttacttgctaccccaatatatcaggcggatgcattgata
caggttgaacaaaagcaaggtaacgcgatacttagcagtctgagccaagtctttcctgat
agtcagcctcaatcagcacctgaaattacactactgcaatcacgaatgatattgggtaag
accgtagatgatttaaatttacaagtcaaggtcgaagaattatttttccccgtcattggt
caaggattagcgcgtctttttaataaaacaaaaaatactattcaggtacataaacttttt
atttcaccgaatatgtatgatgataattttattactttgacagttaaaaatgatcatcaa
tatagtatttctggtgaaaatatagattttgatggggaaattggtcggctcattgataag
aatgggataaggattcaagtcgatagtatcaatgctgaacccgggacaagatttctgtta
acttatacatctcgcataaatgctataaactatttacgggattcattactcatcgcagat
caaggtaaagataccgggatgttaacgatatctcttctcggtagtgatccagatttaatt
aaaagagtaattgatagtataagtgacaattacttagaacaaaatattgcacgccaagca
gctcaagatgcaaagagcttggattttttaaatcaacaattaccaaaagtcagaacagaa
ttaaatgaatctgaagataaattaaatgcatacagaaggcaaaaagattcagtagacctt
tctttggaagctaaatcggttttagatcaaatagtaaatgttgataatcaacttaatgag
ttgacgtttaaagaatctgaaatatcgcaattatatacacaagaacatcctacctataaa
gccttgatggaaaagaggaaaattttacaagatgaaagagcaaagctgaataaacgagta
tcaacaatgcctgaaactcagcaagaggttttgaggttgagtcgtgatgtagaatcaggc
agagctgtttatatgcaattgttaaatcgtcagcaagagttgaatatcgcaaagtcgagc
gcaataggtaatgtcagaataattgacaatgctgtaacacagccaaaaccagtaaaacct
aaaaaattaatcattatagcgattggcctaatttcaggctttgcaatatcgctaggtgtt
gtattcttaagaactttcttacgtagaggaatagagtctcccgaacagcttgaggattta
ggaataacagtatatgcaagtatacctgtagctgaggtattatcaaatcgggcgaagcaa
ccaagtaaaatcaggtttaaaaaggaagaggacgctaattatacttatctggcgactagt
cacccaacagatctggctatagaggcaataagaggacttcgaacgagtctacattttgca
atgatggaagctcgcaataatatattaatgatctctggtgcaagtccaaacgcaggaaaa
acttttgtaagttcaaacttagggggcgtaatagcacagacgggtaaaaaaatactattt
attgatgccgatctaagaaaaggctatacgcataaaatatttaacgagtcaaatgaaaat
ggattgtctgagtatctttcggggaaaataaaattagaagacacaattaagcatcttggt
tctgaaggatttgatttcatttcgagaggtatggcaccaccaaatccagctgaacttttg
atgcatcgacgttttggtgaacttattaaatgggtcagtcaggcatatgatatggtgata
attgatactccgcctattctagcggttaccgatgcagctattataggtaattatgtcgga
actactttacttgttgccaggtttgaacaaaatacaactaaagagttagaagttagcgta
aaacgatttgagcaaagtggtgttgcaataaaaggatgtatcttaaatggagttgtaaaa
aaagcaagtagttactatggttatggctatgcccattatggttattcttataaagatgaa
aaataa

DBGET integrated database retrieval system