KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH31: KPNIH31_21485Help
Entry
KPNIH31_21485     CDS       T03467                                 

Definition
(GenBank) ribose 5-phosphate isomerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
kpy  Klebsiella pneumoniae subsp. pneumoniae KPNIH31
Pathway
kpy00030  Pentose phosphate pathway
kpy01100  Metabolic pathways
kpy01110  Biosynthesis of secondary metabolites
kpy01120  Microbial metabolism in diverse environments
kpy01130  Biosynthesis of antibiotics
kpy01200  Carbon metabolism
kpy01230  Biosynthesis of amino acids
Module
kpy_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
kpy_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
kpy_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:kpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KPNIH31_21485
Enzymes [BR:kpy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     KPNIH31_21485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC
Motif
Other DBs
NCBI-ProteinID: AIX86058
UniProt: A0A1Y0PYG2
LinkDB All DBs
Position
complement(4355558..4356217)
Genome map
AA seq 219 aa AA seqDB search
MTQDELKKAVGWAALQYVQPGTIVGVGTGSTAAHFIDALGTMKGQIEGAVSSSDASTEKL
KSLGITVFDLNSVDRLGIYVDGADEINGHMQMIKGGGAALTREKIIASVADKFICIADAS
KQVDILGKFPLPVEVIPMARSAVARQLVKLGGRPEYRQGVVTDNGNVILDVHGLEILDAI
ALENAINGIPGVVTVGLFANRGADVALIGTADGVKTIVK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggatgaactgaaaaaagcggtaggttgggcagcactgcaatatgtacagcca
gggactattgtcggcgtaggcaccggctcgacggcggcccattttattgacgcgctgggc
accatgaaggggcagatcgaaggggcggtttccagctccgacgcctccaccgagaagctg
aaaagcctcgggatcaccgtcttcgatcttaacagcgtcgatcgcctggggatctatgtt
gacggcgcggatgagatcaacggccatatgcagatgatcaaaggcggcggcgcggcgctg
acccgtgaaaagatcatcgcctcggtcgcggataaatttatctgcatcgccgacgcctcc
aagcaggtcgatattctgggcaagttcccgctgccggtggaagtcattccgatggcgcgc
agcgccgtggcgcgtcagctggtcaagctgggcggccgtccagagtaccgtcagggcgtg
gtgaccgataacggcaacgtgatccttgacgtgcacggcctggaaattctcgatgcgatc
gcgctggaaaacgcgatcaacggtattcctggcgtcgtcaccgtggggctgttcgccaac
cgtggcgccgacgtggcgctgattggtactgccgacggcgtgaagaccatcgtaaaatag

DBGET integrated database retrieval system