KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH31: KPNIH31_23095Help
Entry
KPNIH31_23095     CDS       T03467                                 

Definition
(GenBank) oxidoreductase
  KO
K08322  L-gulonate 5-dehydrogenase [EC:1.1.1.380]
Organism
kpy  Klebsiella pneumoniae subsp. pneumoniae KPNIH31
Pathway
kpy00040  Pentose and glucuronate interconversions
kpy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KPNIH31_23095
Enzymes [BR:kpy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.380  L-gulonate 5-dehydrogenase
     KPNIH31_23095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Shikimate_DH TrkA_N DapB_N PALP NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: AIX86361
UniProt: A0A1Y0PUZ6
LinkDB All DBs
Position
4654240..4655256
Genome map
AA seq 338 aa AA seqDB search
MRSVVVKEPGQLNIESRPVPVPGAHEVRVKIAFAGICGSDVHIYHGHNPFAKYPRVIGHE
FYGIIDAVGEQVSPARIGERVAVDPVVSCGHCYPCSVGRPNVCTQLQVIGVHRDGGFSDY
ACVPAKNAWRIPEAISDRQATMVEPFTIAANITAQLQPTAQDIALVYGAGPMGLTIIQAL
KGVYGVKQVIVVDRIAERLQMARENGADLTLDNTDQPLAEQLAQRQLAPTLVIDAACHPA
ILQEAILLASPAARIGILGFSGEASTLTQQSITSKEISIFSSRLNSGRFPLVIDWMEKGL
IRPEALITHCMPLEQVKEAMEIFANDRKTCCKVLLQLG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgagaagcgtcgtcgtcaaagagccaggccaactgaacattgaatcacgtccggttcca
gttccgggcgcccatgaagtacgggtgaaaattgcttttgccgggatctgtggttccgat
gtacacatctatcacggccacaaccctttcgcgaaatatccccgcgtcatcggccatgaa
ttctatggcatcatcgacgccgtcggcgagcaggtatctccggcacgcatcggcgagcgt
gtcgcggtggaccccgttgtcagctgcggccattgttatccttgctcggtaggaaggccg
aatgtctgtacgcagctccaggtcataggagttcaccgcgacgggggatttagcgactat
gcctgcgtgccggcgaaaaatgcctggcgcatccccgaggctatcagcgaccgtcaggca
acgatggttgagccttttaccatcgcggcaaatattaccgcccagctgcagcccacggcg
caagatattgccctggtttacggcgctggcccgatggggctgacgatcattcaggcgcta
aagggggtatatggcgttaagcaggtgatcgtcgtggatcgcattgccgaacgtctgcag
atggcccgggaaaacggcgccgatctgacgctcgataacactgaccagccgctcgcggaa
cagctggcgcagcggcagcttgcccccacgctggtcattgatgccgcctgccacccggcg
atcctgcaggaagccattctcctcgcctcccccgccgcccgcatcggtatactcggtttc
tccggcgaggcctcgaccctcactcagcaaagcatcaccagtaaagaaatttctattttc
tcctcccggctgaacagcgggcgttttccgctggtcatcgactggatggagaaaggcctt
attcgtccggaggcgttaatcacccattgtatgccgctggagcaggtgaaagaggccatg
gagatttttgctaacgaccgtaagacctgctgcaaagtgctgctgcagctgggttaa

DBGET integrated database retrieval system