KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH27: KPNIH27_00915Help
Entry
KPNIH27_00915     CDS       T03370                                 

Definition
(GenBank) hydrolase
Organism
kpz  Klebsiella pneumoniae subsp. pneumoniae KPNIH27
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 S6PP Hydrolase Hydrolase_6 HAD
Motif
Other DBs
NCBI-ProteinID: AIA39933
LinkDB All DBs
Structure
PDB: 

Position
189686..190486
Genome map
AA seq 266 aa AA seqDB search
MYQVVASDLDGTLLSPDHFLTPYAKETLKLLTARGINFVFATGRHYIDVGQIRDNLGIRS
YMITSNGARVHDSDGQQIFAHNLDRDIAADLFEIVRNDPKIVTNVYREDEWYMNRHRPEE
MRFFKEAVFNYKLYEPGELDPQGISKVFFTCEDHEHLLPLEQAMNARWGDRVNVSFSTLT
CLEVMAGGVSKGHALEAVAKMLGYTLSDCIAFGDGMNDAEMLSMAGKGCIMANAHQRLKD
LHPELEVIGSNADDAVPHYLRKLYLD
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaggttgttgcgtctgatttagacggcacgctgctttcccccgatcatttcctg
accccctatgccaaagagacgctgaagctgcttaccgcccgtgggatcaatttcgtcttc
gccaccggccgtcactacatcgacgtcgggcaaatccgcgataatcttggcatccggtcg
tacatgatcacctctaacggcgcccgcgttcacgatagcgatggtcagcaaatctttgcc
cataacctcgatcgcgatattgccgccgacctgtttgagatcgtgcgtaacgacccgaaa
atcgtcactaacgtttatcgggaagacgagtggtatatgaaccgccatcgtccggaagag
atgcgcttcttcaaggaggcggtgtttaactacaagctgtatgagccgggcgaactggat
ccgcaggggatcagcaaagtattctttacctgcgaggatcatgagcatctgctgccgctg
gagcaggcgatgaacgcccgctggggcgatcgggtgaacgtcagcttctccaccttaacc
tgcctggaagtcatggcgggtggggtatcgaaggggcatgcgctggaggcggtggcgaag
atgctcggctacactctttccgattgcatcgccttcggcgacggtatgaacgacgctgag
atgctgtcgatggctggcaaaggctgcatcatggccaacgcccaccagcggctgaaggat
ctgcatccggaactggaagtgatcggcagtaacgccgacgatgctgtcccgcactacctg
cgtaagctatacctcgactga

DBGET integrated database retrieval system