KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH27: KPNIH27_15265Help
Entry
KPNIH27_15265     CDS       T03370                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
kpz  Klebsiella pneumoniae subsp. pneumoniae KPNIH27
Pathway
kpz00240  Pyrimidine metabolism
kpz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    KPNIH27_15265
Enzymes [BR:kpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     KPNIH27_15265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: AIA42629
LinkDB All DBs
Position
complement(3141421..3142038)
Genome map
AA seq 205 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAR
LYNPQTSLFDDIAAEHQLKPIHCVLVDESQFLTREQVHELSEVVDTLDIPVLCYGLRTDF
RGELFTGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQEGRPYNEGEQVVIGGNERYVS
VCRKHYKEALSVGSLTKVQNQHRPC
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcacaactttatttctactactctgcaatgaatgcaggtaagtcgaccgctctgttg
caatcttcgtacaattaccaggagcgggggatgcgtaccgtcgtttataccgctgagatt
gatgaccgctttggcgccggaaaagtcagttcgcgtatcgggctctcctcgccggcccga
ttgtataatccacagacctcgttatttgacgatattgcggcggagcaccagctaaagccg
attcactgcgtgctggtggatgaaagccagtttctgacgcgtgaacaggttcatgagctg
tccgaagttgtcgatacgctggatattccggtgctttgctatgggttgcggacggacttt
cgcggtgagctctttaccggcagccagtatttactggcctggtcagataagctggttgag
ctgaaaacgatctgcttctgcggccgcaaggccagcatggtattgcgcctcgatcaggag
gggcgtccttataatgagggtgagcaggtcgtcatcggcggtaatgagcggtacgtatcg
gtctgccgtaagcattataaagaggcgctgagcgtcggttcgttaaccaaggtacaaaac
cagcaccgtccctgctga

DBGET integrated database retrieval system