KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH27: KPNIH27_17395Help
Entry
KPNIH27_17395     CDS       T03370                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
kpz  Klebsiella pneumoniae subsp. pneumoniae KPNIH27
Pathway
kpz00010  Glycolysis / Gluconeogenesis
kpz00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:kpz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPNIH27_17395
   00500 Starch and sucrose metabolism
    KPNIH27_17395
Enzymes [BR:kpz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     KPNIH27_17395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AIA43029
LinkDB All DBs
Position
complement(3587557..3588951)
Genome map
AA seq 464 aa AA seqDB search
MKTFPTDFLWGGATAANQVEGAYLEDGKGLSTSDVQPHGVFGEVVERVPGDSGIKDVAID
FYHRYPEDIALFAEMGFNCLRVSIAWTRIYPNGDDAEPNEAGLAFYDKLFDEMAKHNITP
LVTLSHYEMPWALVKNYGGWGSREVIGFFERYARTVFSRYKNKVKLWLTFNEINMSLHAP
MTGVGLPAGSSKGEVYQAIHHQLVASALAVKACHELVPEGKIGNMLLGGLMYPLSCKPED
VFETLQENRSWQFFGDVQARGAYPGYMQRYFRDNGITLNITDADREALKTTVDFISFSYY
MTGCVTADEALNQQARGNILSMVPNPHLASSEWGWQIDPLGLRTLLNVLWDRYQKPLFIV
ENGLGAKDKVEADGSINDDYRISYLNDHLVQAREAIDDGVELMGFTSWGPIDLVSASKAE
LSKRYGFIYVDRHDDGTGTLARSKKKSFGWYKEVIASRGASLKA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattcccgacggattttttatggggcggcgcgaccgcggccaatcaggtggaa
ggtgcttatctggaagatggcaaaggcttatccacctccgatgtgcagccgcacggcgtt
ttcggcgaagtggtcgagcgcgtacccggcgacagcggcataaaagatgtggcgatcgat
ttttaccatcgctatccggaagatatcgccctgtttgccgagatgggctttaactgcctg
cgagtctccatcgcctggacccgcatctaccccaacggcgacgatgccgagccgaacgaa
gccggcctcgccttctacgacaagctgttcgacgagatggcgaagcacaacatcaccccg
ctggtgacgctgtcgcattatgaaatgccatgggcgctggtaaaaaactacggcggctgg
ggcagccgggaggtgattggcttctttgagcgctacgcccggacggtgttcagccgctat
aaaaataaggtcaaactgtggctgacctttaacgaaatcaatatgtcgctgcatgccccg
atgaccggcgtcggcctgccggccggcagcagcaaaggcgaggtgtatcaggcgattcac
caccagctggtggccagcgcgctggcggtcaaagcctgtcatgagctggtgcctgagggc
aaaatcggcaatatgctgctcggcgggctgatgtatcccctgagctgcaaaccggaggat
gtgttcgagacgctgcaggagaaccgcagctggcagttcttcggcgacgtacaggcgcgc
ggcgcgtacccgggctatatgcagcgctatttccgtgacaacggcatcacgctcaacatc
accgacgccgatcgtgaagcgctaaaaaccaccgtcgactttatctccttcagctactac
atgaccggctgcgtcaccgccgacgaggcgctgaaccagcaggcgcgcggcaatattctc
agcatggtgccgaacccgcacctggcgagctcggagtggggctggcagatagacccgctg
ggcctgcgcacgctgctgaacgtgctgtgggatcgctaccagaagccgctgtttatcgtg
gaaaacggtctgggcgccaaagataaggtggaagccgacggcagcattaacgatgactac
cgcatcagttacctgaacgaccacctggtgcaggcgcgggaagccattgacgatggcgtt
gagctgatgggctttaccagctggggaccgattgacctggtgagcgcctcaaaggcggag
ctgtcgaagcgctacggctttatctatgtcgaccgccatgatgacggtaccggcaccctg
gcgcgcagtaagaagaagagctttggctggtataaagaggtgattgccagccgcggcgcc
agcctgaaagcctaa

DBGET integrated database retrieval system