KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH27: KPNIH27_20480Help
Entry
KPNIH27_20480     CDS       T03370                                 

Definition
(GenBank) fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
kpz  Klebsiella pneumoniae subsp. pneumoniae KPNIH27
Pathway
kpz00051  Fructose and mannose metabolism
kpz01100  Metabolic pathways
kpz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KPNIH27_20480
Enzymes [BR:kpz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     KPNIH27_20480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AIA43616
LinkDB All DBs
Position
complement(4236021..4236668)
Genome map
AA seq 215 aa AA seqDB search
MERNRLARQIIDTCLEMTRLGLNQGTAGNVSVRYQGGMLITPTGIPYEKLTEDKIVFIDA
DGQHEQGKLPSSEWRFHQAAYQTRPDAQAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG
NSIPCAPYATFGTRELSEHVAVALKHRKATLLQHHGLIACEASLEKALWLAHEVEVLAQL
YLSTLAITDPVPVLDDEAIAIVLEKFKTYGLRIEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaacagactggcccggcagattatcgatacctgcctggaaatgacccgcctg
gggttaaatcaggggaccgccggcaatgtcagcgtgcgctatcagggaggaatgctgatc
acccctaccggtatcccatatgaaaagctgacggaagacaagatcgtctttattgatgcc
gacggccagcatgagcagggaaaactgccctccagcgaatggcgttttcatcaggcggcc
taccagacgcgacccgatgcccaggcggtggtccacaatcacgctgtccattgtacggcg
gtgtcgatcctcaaccggcccatcccggccattcactatatgatcgccgcggccggcggg
aattcgatcccctgcgcgccctatgccaccttcggcacccgcgaactgtctgagcatgtc
gcggtggcgctgaagcaccgcaaagccacgctgctgcagcatcacggcctgatcgcctgc
gaggccagcctggagaaagcgctctggctggcgcatgaagtggaggtcctggcccagctc
tacctcagtacgctggcgattaccgacccggtcccggtgctggatgacgaggcgatcgcc
atcgtgctggagaagttcaaaacctacggattacgcattgaagagtga

DBGET integrated database retrieval system