KEGG   Kribbella qitaiheensis: F1D05_32195
Entry
F1D05_32195       CDS       T06749                                 

Definition
(GenBank) isoprenyl transferase
  KO
K21273  trans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.88]
Organism
kqi  Kribbella qitaiheensis
Pathway
kqi00900  Terpenoid backbone biosynthesis
kqi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kqi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    F1D05_32195
Enzymes [BR:kqi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.88  trans,polycis-polyprenyl diphosphate synthase [(2Z,6E)-farnesyl diphosphate specific]
     F1D05_32195
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-ProteinID: QNE21732
LinkDB
Position
6798178..6798963
AA seq 261 aa
MGAVVAPEGHPSGARAPGVPAELVPRHVAVVMDGNGRWAKARNLPRTEGHKAGEASLLDV
IKGGIEIGVKYLSVYAFSTENWARSPEEVKFLMGFNREVIHRRRDELDAMGVRVVWSGRR
PRLWKSVISELEDAQERTKNNDTITLQFCVNYGGQAEIADAMRSIAQEVAAGKLSPDRIT
EKTIAKHLYAPDIPPVDLFVRSSGEQRTSNFLVWQLAYAEMVFLDTLWPDFDRRHLWHAI
ELYAQRDRRYGGAIPNLVEPT
NT seq 786 nt   +upstreamnt  +downstreamnt
gtgggggcggtggttgcgccggaggggcatccgtcgggagccagggcgccgggggtgcct
gctgagctggtgcctcggcatgtggcggtggtgatggacgggaacgggcggtgggccaag
gcgcggaatctgccgcggaccgaggggcacaaagccggtgaggcctcgctgctggatgtg
atcaagggcggcatcgagatcggggtcaaatacctgtcggtatacgcgttctcgacggag
aactgggcccggtcgccggaagaggtcaaattcctgatggggttcaaccgcgaggtgatc
catcggcgtcgcgatgagctggatgcgatgggggtccgcgtggtgtggtcggggcgccgg
ccgcggttgtggaagagcgtcatctccgagttggaggacgcgcaggagcggacgaagaac
aacgacacgatcaccctgcagttctgcgtgaactacggcgggcaggcggagatcgccgac
gcgatgaggtcgatcgcgcaagaggttgccgctggcaagctcagtccggaccggatcacc
gagaagacgatcgccaagcacctgtacgcacccgacatcccgccggttgatctgttcgtc
agatcgtcgggggagcagcgcacctcgaacttcctggtctggcagctcgcgtacgccgag
atggtcttcctcgacaccctctggccggacttcgaccgccgtcatctgtggcacgcgatc
gagctctacgcccagcgcgaccgccgctacggcggcgccatccccaacctcgtcgaaccc
acctga

DBGET integrated database retrieval system