KEGG   Klebsiella quasipneumoniae: AVR78_00610Help
Entry
AVR78_00610       CDS       T04389                                 

Definition
(GenBank) ribose 5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
kqu  Klebsiella quasipneumoniae
Pathway
kqu00030  Pentose phosphate pathway
kqu01100  Metabolic pathways
kqu01110  Biosynthesis of secondary metabolites
kqu01120  Microbial metabolism in diverse environments
kqu01130  Biosynthesis of antibiotics
kqu01200  Carbon metabolism
kqu01230  Biosynthesis of amino acids
Module
kqu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
kqu_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:kqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AVR78_00610
Enzymes [BR:kqu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     AVR78_00610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC
Motif
Other DBs
NCBI-ProteinID: AMR12946
UniProt: A0A1C1EKA9
LinkDB All DBs
Position
complement(3000776..3001435)
Genome map
AA seq 219 aa AA seqDB search
MTQDELKKAVGWAALQYVQPGTIVGVGTGSTAAHFIDALGTMKGQIEGAVSSSDASTEKL
KSLGITVFDLNSVDRLGIYVDGADEINGHMQMIKGGGAALTREKIIASVADKFICIADAS
KQVDILGKFPLPVEVIPMARSAVARQLVKLGGRPEYRQGVVTDNGNVILDVHGLEILDAI
ALENAINGIPGVVTVGLFANRGADVALIGTADGVKTIVK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggatgaactgaaaaaagcggtaggttgggcggcgctgcaatacgtacagcca
gggaccattgtgggcgtaggcaccggctcgacggcggcccattttattgacgcgctgggc
accatgaaggggcaaatcgaaggggcggtttccagctccgatgcctccaccgagaagctg
aaaagcctcgggatcaccgtcttcgatctcaacagcgtcgatcgcctggggatctacgtt
gacggcgcggatgagatcaacggccacatgcagatgatcaaaggcggcggcgcggcgctg
acccgtgagaagatcatcgcctcggtagcggataaatttatctgcatcgccgatgcctcc
aagcaggtcgatattctgggtaaattcccgctgccggttgaggtcattccgatggcgcgc
agcgccgtggcgcgccagctggtcaagttgggcggccgtccggaataccgtcagggcgtg
gtgaccgataacggcaacgtgatccttgacgtgcacggcctggaaattctcgatgctatc
gcgctggaaaacgcgattaacggcattcctggcgtcgtgaccgtggggctgttcgccaac
cgcggcgccgacgtggcgctgatcggcaccgctgacggtgtgaaaaccatcgtaaaatag

DBGET integrated database retrieval system