KEGG   Klebsiella quasipneumoniae: AVR78_01605
Entry
AVR78_01605       CDS       T04389                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
kqu  Klebsiella quasipneumoniae
Pathway
kqu00052  Galactose metabolism
kqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AVR78_01605
Enzymes [BR:kqu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     AVR78_01605
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C TrkA_N Methyltransf_25 2-Hacid_dh_C 3HCDH_N MTS UDPG_MGDP_dh_N Methyltransf_31 ELFV_dehydrog PrmA Methyltransf_24 Methyltransf_11 CoA_binding Pyr_redox_2 Shikimate_DH Pyr_redox Met_10 Peptidase_U32
Other DBs
NCBI-ProteinID: AMR13133
UniProt: A0A658ALJ9
LinkDB
Position
3194377..3195420
AA seq 347 aa
MKSVVIHAEGNVCVEERPIPTLQTENDVLVKVVSSGLCGSDIPRIFAKGAHYYPITLGHE
FSGYVESYGAAVTDLQPGDAVACVPLLPCFQCPQCQREYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPDQMPIDDGAFIEPITVGLHAFHLAQGCEGKNVIIIGAGTIGLLALQCA
RELGANSVTAIDINPQKLELAKTLGATRVFNSREMSGQAIQQALEAIQFDQLVLETAGTP
QTVALAIEAAGPRAQLALVGTLHHDLTLPAATFGQILRKELNIVGSWMNYSGPWPGEEWQ
TATRLLTEKRLQLAPLIAHRGDAESFAREVQALNGAPMQGKILLKLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtaatccatgctgaggggaacgtctgcgttgaagaacgccctatccct
acgctgcaaacggaaaacgatgtcctggtcaaagtagtcagttccggattatgcggctct
gatatcccgcgcattttcgccaaaggcgcgcattactaccctattacgctgggacacgaa
ttcagcggctatgtggaatcctacggcgcggcggtaaccgacctgcagcccggcgatgcc
gtcgcctgcgtgccgctgctgccctgcttccagtgcccgcagtgccagcgcgagtatttc
tctttatgtaaacagtatcagttcgtcggctcacgcagcgaaggcggcaacgccgaatat
gtggtggtaaagcgcgccaacctgttccgcctgccggaccagatgccaattgatgacggc
gcgtttatcgaaccgataaccgttggcctgcacgctttccatctggcgcagggctgcgaa
ggtaaaaacgtgattattatcggtgccggcaccattggcctgctggcgctgcagtgcgcc
cgcgaactgggcgccaacagcgtcacggcgatcgatatcaatccgcagaaactggaactg
gccaaaacccttggcgcaacccgtgtgttcaacagccgcgagatgagcggccaggcgatt
cagcaggctctggaagccattcagttcgaccagttagtcctcgagaccgccggtacgccg
cagaccgtcgcattagcgattgaagccgccgggccgcgggcgcagctggcgctggtcggc
acgctccatcacgatttaaccctcccggccgccaccttcgggcagatcctgcgcaaggag
ttgaatattgtcggtagctggatgaactactctggcccgtggccaggagaagagtggcaa
acggccacccgcctgctgacagaaaaacgcctgcagctggcgccgctgatcgcccaccgc
ggtgacgcggagagctttgcgcgtgaagtgcaggcgctcaacggcgcgccgatgcagggc
aaaatcctgctcaaactctcctga

DBGET integrated database retrieval system