KEGG   Klebsiella quasipneumoniae: AVR78_02810Help
Entry
AVR78_02810       CDS       T04389                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kqu  Klebsiella quasipneumoniae
Pathway
kqu00564  Glycerophospholipid metabolism
kqu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kqu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AVR78_02810
Enzymes [BR:kqu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AVR78_02810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_oxidored NAD_binding_8 FAD_binding_2 3HCDH_N Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AMR13356
UniProt: A0A1C1EPT9
LinkDB All DBs
Position
3419013..3420521
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEARDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGAESVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVRTRTRAISAKRENG
LWVVEAEDIDSGEKFTWKARGLVNATGPWVKQFFDEGMHLRSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVAIDDKEINYLLNVYNAHF
KKTLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGQAPLLSVFGGKLTTYRK
LAEHALEKLTPYYKGIGPAWTKTAVLPGGDIGGDRDDYAAKLRRRFPFISESLARHYART
YGSNSEWILKEASALSDLGEDFGHEFYEAELKYLVEHEWVRSLDDAIWRRTKQGMWLNGE
QQARISEWLAQHAGKSELSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatctgattgtgataggcggaggcatcaacggtgccggtatcgcggca
gatgccgccgggcgtggtttatccgtactgatgctggaagcgcgcgatctcgcctgcgcc
acctccagcgccagttccaaactgatccacggcgggctacgctacctcgaacactatgag
ttccgcctggtcagcgaagcgctggccgaacgcgaagtgctgttaaaaatggccccgcac
atcgccttcccgatgcgctttcgtctcccgcatcgcccgcatctgcgtccggcatggatg
atccgtatcggcttgtttatgtacgatcatctgggcaaacgcaccagcctgccgggatcc
accggtttgcgttttggcgcagaatcggtacttaagccggaaattgtgcgcggtttcgaa
tattccgactgctgggtcgacgatgcccgcctggtgctggccaacgcgcagatggtcgtc
cgcaaaggcggcgaagtacgcacccgcactcgcgccatctcggcaaaacgagagaatggc
ctgtgggtggtggaagcggaagatattgatagcggcgagaagtttacctggaaggcgcgc
ggtctggtcaatgccaccggtccatgggtcaaacagttcttcgacgaagggatgcatctg
cgctcgccttacggtatccgcctgattaagggcagccacatcgtggtgccgcgggtacat
acccagaagcaggcctacattctgcaaaacgaagataaacgtattgtgtttgttatcccg
tggatggatgagttctcgatcatcggcacgacggacgtcgagtataagggcgatccgaaa
gcggtggccattgatgataaagagattaattacctgctgaacgtctataacgcgcacttt
aaaaagaccctcagccgggacgatatcgtctggacctactccggcgtccgtccgctgtgc
gacgacgagtcggattcgccgcaggcgatcacccgcgactacacgctggatattcacgat
gagaacggccaggcgccgctgctctctgtcttcggcgggaagctgaccacctatcgcaaa
ctggccgagcacgcgctggaaaaactgaccccctattacaaagggatcggcccggcatgg
accaaaaccgcggtgctccccggcggcgatattggcggcgaccgcgacgactacgcggca
aaactgcgccgtcgcttcccgttcatcagcgaatcactggcccgccattatgcccgcacc
tacgggagcaacagcgagtggatcctgaaggaagccagcgccctgagcgatctgggagaa
gattttggccatgagttttatgaagccgagctgaagtatctggttgagcatgaatgggtg
cgcagcctggatgacgccatctggcgccgtaccaaacagggcatgtggctgaatggcgag
cagcaggcgcgcatcagcgaatggctggcgcagcatgcgggaaagtctgagctgtcgtta
gcgtcgtaa

DBGET integrated database retrieval system