KEGG   Klebsiella quasipneumoniae: AVR78_02965Help
Entry
AVR78_02965       CDS       T04389                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kqu  Klebsiella quasipneumoniae
Pathway
kqu00250  Alanine, aspartate and glutamate metabolism
kqu00410  beta-Alanine metabolism
kqu00640  Propanoate metabolism
kqu00650  Butanoate metabolism
kqu01100  Metabolic pathways
kqu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AVR78_02965
   00650 Butanoate metabolism
    AVR78_02965
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AVR78_02965
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AVR78_02965
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kqu01007]
    AVR78_02965
Enzymes [BR:kqu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AVR78_02965
Amino acid related enzymes [BR:kqu01007]
 Aminotransferase (transaminase)
  Class III
   AVR78_02965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AMR13384
UniProt: A0A383Q9D1
LinkDB All DBs
Position
complement(3454884..3456149)
Genome map
AA seq 421 aa AA seqDB search
MKSSELNQRRQQATPRGVGVMCNYFVEKAENATLWDIEGNEVIDFAAGIAVLNTGHRHPK
VVAAVADQLQAFTHTAYQIVPYESYVTLAERINDLAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHGVYPNAAHGVTTA
DALKSLERIFKADIAPDQVAAIILEPIQGEGGFNVAPADFMQALRDLCDTHGILLIADEV
QTGFARTGKLFAMQHYDVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIAEEQLCQRAEQLGSHLQEVLNQARATCPAIVDVRGRGSMVAVEFND
PQTGEPSPEFTRQVQQKAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFSKALDILARVLK
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagctcagaactgaatcaacgtcgccagcaggcgacgccgcgcggcgtaggcgta
atgtgtaactactttgtcgagaaggcggagaacgccacgctttgggatatcgaaggcaat
gaggtgatcgatttcgccgccggtatcgccgtgttaaataccggtcaccgtcatccgaag
gtggtcgccgcggtcgctgaccagctgcaggcgttcacccacaccgcctatcagattgtg
ccgtacgaaagctatgtcacgctggcggaacgtatcaacgatctggcgccgattgacggg
ccggcaaaaacggccttcttcaccaccggcgcggaagcggtcgagaacgcggtgaaaatt
gcccgcgcttataccggtcgtccggggctgataactttcggcggcggtttccacggccgt
acctttatgaccatggccctcaccggtaaggtcgcaccctacaaaatcggcttcgggccg
ttcccgggctcggtgtatcacggtgtctacccgaatgcggcgcatggcgtgaccaccgcg
gatgcgctgaaaagcctggagcgcattttcaaagcggatattgcgccggatcaggtcgcg
gccatcatcctcgagccgatccagggggaaggcggctttaacgtcgcgccggccgatttc
atgcaggcgctgcgcgacctgtgcgatacccacggcattctgctgatcgccgatgaagtg
cagaccggtttcgctcgtaccggcaagctgttcgccatgcagcattatgatgtgaaaccg
gatctgatgacgatggcgaaaagcctcgccggcggtttcccgctgtcgggcgtcgttggt
cgcgccgaggtaatggatgccccagcgccaggcggactgggcgggacctatgccggtaac
ccgctggcggtggccgcggcgcacgcggtgctggatgtgattgccgaagagcagctgtgc
cagcgcgctgagcagctgggtagccatctgcaggaagtgctcaaccaggcgcgcgccacc
tgtccggcgattgtcgatgtccgcggccgggggtcgatggtggcagtggagtttaacgat
ccgcaaactggcgagccgtcgccggagttcacccgccaggtgcaacagaaagcgcaggag
aacggcctgctgctgctgagctgcggcgtctacggcaacgtgatccgcttcctctatccg
ctgacgattccggacgcccagttctcgaaagcgctggatattctggcgcgcgtactgaag
agctaa

DBGET integrated database retrieval system