KEGG   Klebsiella quasipneumoniae: AVR78_04945Help
Entry
AVR78_04945       CDS       T04389                                 

Definition
(GenBank) MOSC domain-containing protein
Organism
kqu  Klebsiella quasipneumoniae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MOSC 3-alpha 7TM_GPCR_Srt
Motif
Other DBs
NCBI-ProteinID: AMR13754
LinkDB All DBs
Position
3878044..3878718
Genome map
AA seq 224 aa AA seqDB search
MHYPVNVFVGKIRDYTGSRPSAIGKIQVDGELQLGDLGLEGDEQAEKKIHGGPDRALCHY
PREHYADWIREFPQHADRFCAPAFGENLSTTGLTEQNVCIGDIFRWGEALIQVTQPRSPC
FKLNFHFSINDMAQLMQNSGKTGWLYRVIAGGKVSSDAPLELVSRLSEVSVHEAGAIAWH
MPFDDDQYHRLLSAAGLSVSWSRTMQKRRLSGKIEDSSRRLWGK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccggtgaatgtctttgtcggcaaaatcagggactacacgggcagtcgtccc
agcgcgatcggcaaaatccaggttgacggcgagttgcagctcggcgatctcggtctcgaa
ggggatgagcaggcggagaagaaaatccacggcgggccggaccgcgcgttgtgtcactat
ccgcgcgaacactatgccgactggatccgtgaattcccccagcatgccgatcggttctgc
gccccggcgttcggcgaaaacctttccaccaccgggctcaccgaacaaaacgtctgcatt
ggcgatatctttcgctggggcgaggcgctgatccaggtcacccagccgcgctctccgtgc
ttcaagctcaactttcatttttcgatcaatgacatggctcagctgatgcaaaacagcggg
aagaccggctggttgtatcgggtgatcgctggggggaaagtctccagcgatgcaccgctc
gagctggtctctcgcctgagtgaggtcagcgtccatgaggccggggcgattgcctggcat
atgccgtttgatgacgatcagtaccaccgcttattgtcggccgcgggcctgtcggtgagc
tggagcagaaccatgcagaagcgccgtttaagcggtaagatcgaggatagttcgcggaga
ttatgggggaaataa

DBGET integrated database retrieval system