KEGG   Klebsiella quasipneumoniae: AVR78_05070Help
Entry
AVR78_05070       CDS       T04389                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
kqu  Klebsiella quasipneumoniae
Pathway
kqu00620  Pyruvate metabolism
kqu00680  Methane metabolism
kqu01100  Metabolic pathways
kqu01120  Microbial metabolism in diverse environments
kqu01200  Carbon metabolism
Module
kqu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:kqu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AVR78_05070
  Energy metabolism
   00680 Methane metabolism
    AVR78_05070
Enzymes [BR:kqu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AVR78_05070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AMR13778
LinkDB All DBs
Position
complement(3902853..3905504)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGDTIKDALGENILDRVETIRKLSKSSRAGNEANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPNGEAASNPEVIARTLRKLKDQPNLNEE
TIKKAVESLSLELVLTAHPTEITRRTLIHKMVEVNNCLKQLDNKDIADYEHHQLMRRLRQ
LIAQSWHTDEIRKHRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEANLGYQLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDVQVLISELSMVECTDELR
ALAGAEGAQEPYRYLMKKLRAQLMETQAWLEARLKGQKLPKPAGLITQNEQLWEPLYACY
KSLQACGMGIIANGELLDTLRRVKSFGVPLVRIDIRQESTRHTEALGEMTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRQWEPSEETREVLDTCRVIAEAPRGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFALPVAPLFETLDDLNNANDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTSAILEANLLPPPEPKPQWRDIMAEL
SDVSCKMYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVEGGKQSELEAMCRDWPFFSTRLGMLEMVYSKADLWLAE
YYDQRLVKPELWALGTELRKLLAADINVVLAIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRQAEEEGKDPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcattgcgtagtaatgtcagtatgctcggcaaggtgctgggc
gataccatcaaggatgcattgggagaaaatattcttgatcgtgtcgaaactatccgtaag
ttgtccaaatcttcacgcgccggcaacgaagctaaccgccaggagctgctgaccacgctg
cagaatttgtctaacgacgaactgctgccggtagcccgtgccttcagccagttcctgaat
ctggctaacaccgctgagcagtaccatagcatttcgccgaatggcgaagcagccagcaat
ccggaagtcattgcgcgtaccctgagaaagctcaaagaccaacccaatctcaacgaagag
accatcaaaaaagcggtggaatctctttccctggagctggtgttaaccgcccacccgacc
gagatcacccgccggacgctgatccataaaatggtggaggtgaacaactgcctcaagcag
ctggataacaaagatatcgcggactacgagcaccaccagctgatgcgccgtctgcgccag
ctgatcgcccagtcctggcataccgatgaaattcgtaagcaccgcccttccccggtcgat
gaagccaaatggggcttcgcggtggtggaaaacagcctgtgggaaggggtgcctaactac
ctgcgcgagctgaacgaacagctggaagccaacctcggctatcagctgccggtggacttt
gtcccggtgcgtttcacttcgtggatgggcggcgaccgcgacggcaacccgaacgtgacc
gccgatatcacccgccacgtgctgctgctcagccgctggaaagcgaccgatctgttcctt
aaagatgtgcaggtgctgatctccgagctgtcgatggtggagtgtaccgacgaattgcgc
gctctggccggcgccgagggcgctcaggaaccgtaccgttacctgatgaaaaaactgcgc
gctcagctgatggaaacccaggcctggctggaagcgcgtctgaaaggccagaagctgccg
aaaccggcgggactgatcacgcagaacgagcagctgtgggagccgctgtacgcctgttat
aaatcgctgcaggcctgcggcatgggcattatcgccaacggcgagctgctcgacacccta
cgccgcgtgaagtctttcggcgtaccgctggtgcgtattgatattcgtcaggaaagcacc
cgccacaccgaagcgctgggtgaaatgacccgttacctcgggatcggcgattacgaaagc
tggtcagaagccgacaaacaggctttcctgatccgcgaactgaattccaaacgtccgctg
ctgccgcgccagtgggagcccagcgaagagacccgcgaagttctcgacacctgcagagtg
atcgccgaggcgccgcgcggatcgatcgccgcctacgtgatctcgatggccaaaacgccg
tccgacgtgctggcggttcacctgctgctgaaagaggccgggattggcttcgccctgccg
gtggctccgctgttcgaaacgctggacgacctgaacaacgccaacgacgtcatgacccag
ttgctgaatatcgactggtaccgcggctttatccagggcaaacagatggtcatgatcggc
tactctgattccgcgaaagacgcaggggtgatggccgcctcctgggcgcagtaccaggcg
caggatgcgttgatcaaaacctgtgagaaagccgggatcgaactgacgctgttccacggt
cgcggtggctccattggccgcggcggcgcgccggcccacgccgcgctcctctcacagccg
ccgggaagcctgaaaggcggcctgcgcgttaccgagcagggtgagatgatccgctttaag
tacggcctgccggaagtcaccatcagcagcctgtcgctctataccagcgcgatcctcgaa
gccaacctgctgccgccgccggaacccaaaccgcagtggcgcgacatcatggccgagctg
tccgacgtgtcgtgcaagatgtatcgcggctatgtgcgtgaaaacaaagatttcgtgcct
tacttccgctccgccactccggagcaggagttgggcaaactgccgctgggttcgcgcccg
gcaaaacgtcgcccgaccggcggcgtcgagtcgctgcgcgccattccgtggatcttcgcc
tggacccagaaccgcctgatgcttccggcctggctgggcgctggcgctgcgctgcagaag
gtagtcgaaggcggaaaacagagtgaactggaagcgatgtgtcgcgactggccgttcttc
tccacccgcctcggcatgctggagatggtttactcgaaggccgacctgtggctggcggag
tattacgatcagcgcctggtgaaaccggagctgtgggcgctgggtaccgagctgcgcaag
ctgctggctgccgatatcaacgtcgtgctggccatcgccaacgactcccatctgatggct
gacctgccgtggatcgccgagtctatccagctgcgtaatatctataccgacccgctgaac
gtcctgcaggcggaactgctgcaccgttcacgccaggctgaagaagagggcaaagacccg
gatccgcgcgttgaacaagcgctgatggtcaccatcgccggcgtcgccgccggtatgcgt
aacaccggctaa

DBGET integrated database retrieval system