KEGG   Klebsiella quasipneumoniae: AVR78_09595Help
Entry
AVR78_09595       CDS       T04389                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
kqu  Klebsiella quasipneumoniae
Pathway
kqu00250  Alanine, aspartate and glutamate metabolism
kqu00280  Valine, leucine and isoleucine degradation
kqu00410  beta-Alanine metabolism
kqu00640  Propanoate metabolism
kqu00650  Butanoate metabolism
kqu01100  Metabolic pathways
kqu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AVR78_09595
   00650 Butanoate metabolism
    AVR78_09595
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AVR78_09595
   00280 Valine, leucine and isoleucine degradation
    AVR78_09595
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AVR78_09595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kqu01007]
    AVR78_09595
Enzymes [BR:kqu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AVR78_09595
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AVR78_09595
Amino acid related enzymes [BR:kqu01007]
 Aminotransferase (transaminase)
  Class III
   AVR78_09595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AMR14580
LinkDB All DBs
Position
complement(4838022..4839305)
Genome map
AA seq 427 aa AA seqDB search
MNSNKALMARRSDAVPRGVGQIHPIFAERAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
QIVAAVEDQLKKLSHTCFQVLAYEPYLALCEKMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATGRSGAIAFTGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALYPCALHGVSD
DEAIASIHRIFKNDAAPEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAADITTFAKSIAGGFPLAGVTGRAEVMDAIAPGGLGGTYAG
NPIACAAALAVLQIFEQENLLEKANQLGDTLRQGLLAIAEDHPEIGDVRGLGAMIAIELF
EEGDHSRPNARLTADIVARARDKGLILLSCGPYYNVLRILVPLTIEEAQIEQGLKIIADC
FTEAKQA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaataaagcattaatggcgcgtcgcagcgacgcggtcccgcgcggcgtcggc
cagatccatcctatcttcgccgagcgcgcggagaactgccgggtgtgggacgtcgaaggg
cgggaatatctcgattttgccggcggtatcgcggtgctcaataccggccacctgcatccg
cagattgtcgccgccgtggaggaccagctgaaaaagctgtcccatacctgcttccaggtg
ctggcctacgagccctacctggcgctgtgcgaaaagatgaaccagaaggtgccaggtgat
ttcgccaagaaaaccctgctggtcaccaccgggtcggaagcggtggagaacgcggtgaag
atcgcccgcgcggcaaccgggcgcagcggcgctatcgccttcaccggcgcctatcacggc
cgtacccactacaccctgtcgctgaccggtaaagtgaatccttactccgccggtatgggc
ttaatgccgggccacgtctatcgcgccctctacccgtgcgcgctgcacggcgtcagcgat
gacgaggcgatcgccagcatccatcgcatcttcaaaaacgatgccgcgccggaagatatc
gccgccatcattatcgagccggtgcagggtgaaggcggattctatgccgcctccccggcc
tttatgcagcgcctgcgcgccctgtgcgacgagcacggcattatgctcatcgccgatgag
gttcagagcggcgcgggccgcaccggtaccctgttcgccatggagcagatgggcgtcgcg
gcggatatcaccaccttcgccaaatccatcgccggcggtttcccgctggcgggcgtcacc
ggccgcgcggaagtgatggacgccatcgcccccggcggactgggcggcacctacgccggc
aaccccatcgcctgcgccgccgccctggcggtattgcagattttcgagcaggaaaacctg
ctggaaaaagccaaccagctcggcgataccctgcgccagggcctgctggcgatcgctgaa
gatcatccggagatcggcgatgtccgcggtctgggagcgatgatcgccatcgagctgttt
gaagaaggcgaccacagcagaccgaatgcaagactcacggcggatatcgtcgcccgcgcg
cgcgacaaaggcctgatcctgctctcctgcgggccgtactacaacgtactgcgcatcctg
gtgccactgactatcgaagaggcgcagatcgagcaggggctgaagatcatcgccgactgc
tttaccgaggcgaaacaggcatag

DBGET integrated database retrieval system