KEGG   Klebsiella quasipneumoniae: AVR78_09995Help
Entry
AVR78_09995       CDS       T04389                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
kqu  Klebsiella quasipneumoniae
Pathway
kqu00730  Thiamine metabolism
kqu00790  Folate biosynthesis
kqu01100  Metabolic pathways
kqu02020  Two-component system
Module
kqu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kqu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    AVR78_09995
   00790 Folate biosynthesis
    AVR78_09995
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AVR78_09995
Enzymes [BR:kqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AVR78_09995
Exosome [BR:kqu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AVR78_09995
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kqu00537]
 Enzymes
  AVR78_09995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: AMR14655
LinkDB All DBs
Position
4922573..4924003
Genome map
AA seq 476 aa AA seqDB search
MEMTKVKLSALFIALLPLLGSPVIHAETTTAPVLENRAAQGDITTPGGARRLTGDQTEAL
RASIINKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYSLDKKT
GKPDYVTDSAASATAWTTGVKTYNGALGVDIHENAHQTILELAKAAGLATGNVSTAELQD
ATPAALVAHVTSRKCYGPTVTSEKCPSNALEKGGKGSITEQLLNARPDVTLGGGAKTFAE
TATAGEWQGKTLREQAEARGYQIVTDAASLAAATEASQDKPLLGLFADGNMPVRWEGPKA
SYHGNIDKPPVTCTPNPKRDASVPTLAQMTEKAIDLLSRHEKGFFLQVEGASIDKQDHAA
NPCGQIGETVDLDEAVQKALEFAKKDGNTLVIVTADHAHASQIIPADSKAPGLTQALNTH
DGAVMVMSYGNSEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLFSTMKAALSLK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggagatgacaaaagtgaaattaagcgccctgtttattgccctgctgcctctgctgggc
tcgccggttattcatgcggaaaccacgaccgcgccggttctggaaaatcgcgctgcccag
ggagatatcactactcccggcggcgcgcgtcgtttaacgggcgatcaaaccgaagcgctg
cgcgcctcgataatcaataagccggccaaaaacattatcttgctgattggcgatgggatg
ggcgattctgaaattaccgctgcgcgaaattatgcggaaggggcgggcggtttctttaaa
ggcattgacgccctgccgttaaccgggcagtacacgcactattcgctggataaaaaaacc
ggtaaaccggactacgtcaccgactcggcggcctccgccaccgcctggaccaccggcgtg
aagacctataacggcgcgctgggcgtcgatattcatgagaacgcgcatcagaccatcctc
gaactggcgaaagcggcgggactggccaccggcaacgtttccaccgccgagctgcaggac
gctacccccgcggcgctggtggcgcatgtgacatcgcgtaaatgctacggccctacggtt
accagcgaaaaatgccccagcaatgcgctggagaaagggggcaaaggctccattaccgaa
cagctgctgaacgcccggccggatgtcaccctgggcggcggcgcgaagacttttgccgaa
acggcgacggcgggcgagtggcagggcaaaaccctgcgtgagcaggcggaagcgcgcggc
taccagattgtgaccgacgcggcctctcttgccgccgcgacggaagccagccaggataaa
ccgctgctgggactcttcgccgacggcaatatgccggtacgctgggaagggcccaaggcg
tcttatcacggtaatatcgataagccgccggtaacctgtaccccaaacccgaaacgcgac
gcctcggtgccgacgctggcgcagatgacggagaaagcgattgacctgctgagccgccac
gagaaaggcttcttcctgcaggtggaaggtgcctccatcgataagcaggatcatgcggcg
aatccgtgcggccagatcggcgaaacggttgatctcgacgaggcggtgcagaaggcgctg
gaatttgccaaaaaagacggcaataccctggtgatcgtcaccgccgaccatgcgcacgcc
agccagatcatcccggcggatagcaaagccccgggcctgactcaggctctgaatactcac
gatggcgcagtgatggtcatgagctacggcaactcagaggaagagtcgatggagcacacc
ggcacccagctgcgcattgcggcctacggtccgcatgcggctaacgtcgtcggcctgacc
gatcagaccgacctcttctcaactatgaaagctgccctgagtctgaaataa

DBGET integrated database retrieval system