KEGG   Klebsiella quasipneumoniae: AVR78_10535Help
Entry
AVR78_10535       CDS       T04389                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
kqu  Klebsiella quasipneumoniae
Pathway
kqu00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:kqu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AVR78_10535
Enzymes [BR:kqu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AVR78_10535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4434
Motif
Other DBs
NCBI-ProteinID: AMR14757
LinkDB All DBs
Position
5030079..5032136
Genome map
AA seq 685 aa AA seqDB search
MNKFAPLHPKVNTLLHGADYNPEQWENDPDIIDKDIAMMQQAKCNVMSVGIFSWAKLEPR
EGVFDFAWLDTILDKLYAAGIHVFLATPSGARPAWMSQRYPQVLRVGRDRVPALHGGRHN
HCMSSPIYREKTLKINSLLAERYAAHPAVLGWHISNEYGGECHCDLCQARFRGWLKARYQ
TLENLNQAWWSTFWSHTYSDWSQIESPAPQGETSIHGLNLDWHRFNTAQVTDFCRHEIAP
LKAANAALPVTTNFMEYFYDYDYWQLAEVLDFISWDSYPMWHRDKDETALACYTAMYHDM
MRSLKGGQPFVLMESTPGATNWQPTSKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRIGREVSKLGEILSKLPEVRGCRTEAKVAIIFDQQNRWALDDA
QGPRNLGMEYEKTVNEHYRPFWEQGIAVDVIDADADLTPYRLVIAPMLYMVRDGFAARAE
AFVASGGHLVTTYWTGIVNESDLCYLGGFPGPLRNLLGIWAEEIDCLNDGEFNLVQGLAG
NQCGLQGPYQVRHLCELIHTESAQTLATYRDDFYAGRPAVTVNGFGKGKAWHVASRNDLA
FQRDFFAALSKELALPRAIAADLPPGVVATARTDGESTFVFLQNYSAQSHTLSLPSGYRD
CLTDAAVSDPLTLSAWDCRILRRHA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttgcacctttacatccaaaggttaatacgctgctgcatggcgcggattat
aatccggaacaatgggagaatgaccccgacattattgataaagacattgccatgatgcag
caggcaaaatgcaatgtgatgtcggtgggcatatttagctgggcgaaacttgagccgcgc
gaaggggtatttgatttcgcctggctggatactatcctcgataaactgtatgccgccggc
attcatgtatttctggccacgccgagcggcgcgcgtccggcgtggatgtctcaacgctat
ccgcaggttctgcgggtggggcgcgatcgggtgccggccctgcacggcggccgtcacaac
cactgtatgtcatcgccgatctatcgtgagaagaccctgaaaatcaatagcctgctggcg
gagcgctatgctgcgcacccggcggtgctgggctggcatatttccaatgaatatggcggc
gaatgccattgcgatctctgccaggcccgctttcgcggctggctgaaggcgcggtatcag
accctggagaacctcaaccaggcctggtggagcaccttctggagccatacctatagcgac
tggtcgcagattgaatcgcctgcgccgcagggcgaaacgtcgatccacggtctcaacctt
gactggcatcgctttaacaccgctcaggtgaccgatttctgccgccatgaaatcgccccg
ctgaaggcggcgaatgccgccctgccggtgaccaccaactttatggagtatttctacgat
tacgactactggcagctggcggaggtgctggactttatctcgtgggacagctatccgatg
tggcaccgcgataaagacgaaaccgcgctggcctgctacaccgcgatgtatcacgacatg
atgcgcagcctgaagggcggccagccgtttgtgctgatggagtccacgccgggcgcgact
aactggcagccgaccagcaaactgaagaaaccgggcatgcatattctctcctcgctgcag
gcggtggcgcatggcgccgactcggtgcagtatttccagtggcggaaaagtcgcggttcg
gttgagaaatttcacggcgcggtggtcgaccatgtcgggcacatcgatacccgtattggc
cgtgaagtcagcaaactcggtgagatactgagcaagctaccggaggtccggggctgtcgc
accgaggcgaaagtggcgattatcttcgaccagcagaaccgctgggcgctcgatgacgcc
cagggaccgcgcaatctggggatggagtatgagaagacggtcaatgagcactaccgtccg
ttctgggagcagggcatcgccgtcgatgtgattgacgccgacgctgatttaacgccgtac
cggctggtcattgccccgatgttatacatggtgcgcgacggctttgccgcgcgggcggag
gcgtttgtcgccagcggcggccatctggtgaccacttactggaccggcatcgtcaacgaa
tccgatctctgctatctcggcggcttcccgggcccgctgcgcaatctgctgggcatctgg
gcggaagagatcgactgcctgaatgacggcgagtttaatctggtgcagggcctggccggg
aatcagtgcggtctgcagggcccgtatcaggtgcgccatctctgtgaactgatccatacc
gaaagtgcgcagacgctggccacctaccgggatgatttttatgccggaaggccagcggtg
acggtgaacggcttcgggaaaggtaaagcctggcatgtggcctcccgcaacgatttggcc
ttccagcgcgacttctttgccgccctgagcaaggagctggcgctaccgcgggcgatcgcg
gcggatttaccgcccggcgtggtggctactgcgcgcaccgacggtgagagcacgtttgtc
ttcctgcagaactacagcgcgcaaagccataccctgagcctgccgtcagggtatcgggat
tgcctgaccgacgcggcggtgtcggacccgctaaccctgtcagcatgggattgccgtatt
ctccgtcgccacgcctaa

DBGET integrated database retrieval system