KEGG   Klebsiella quasipneumoniae: AVR78_20120Help
Entry
AVR78_20120       CDS       T04389                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
kqu  Klebsiella quasipneumoniae
Pathway
kqu00240  Pyrimidine metabolism
kqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kqu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AVR78_20120
Enzymes [BR:kqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AVR78_20120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: AMR16507
LinkDB All DBs
Position
complement(1677955..1678572)
Genome map
AA seq 205 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAR
LYNPQTSLYNDIAAEHELKPIHCVLVDESQFLTREQVHELSEVVDTLDIPVLCYGLRTDF
RGELFTGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQEGRPYNEGEQVVIGGNERYVS
VCRKHYKEALSVGSLTQVQNQHRPC
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcacaactttatttctactactctgcaatgaatgcaggtaagtcgaccgctctgttg
caatcttcgtacaattaccaggagcgggggatgcgtaccgtcgtttataccgctgagatt
gatgaccgctttggcgccggaaaagttagctcgcgtatcggtctctcatcgccggcccgt
ttgtataatccacagacgtcgctatataacgatattgccgcagagcacgagttaaaaccg
attcactgcgtgctggtggatgaaagccagtttctgacgcgcgagcaggttcatgagctg
tctgaagttgtcgatacgctggacattccggtgctttgctatggcctgcggacagacttt
cgcggtgagctcttcaccggtagccagtatttgctggcctggtcagataagcttgtggag
ctgaaaaccatctgtttctgcggacgaaaggctagcatggtgctgcgcctcgatcaggag
gggcgtccttataatgagggcgagcaggtcgtcatcggcggtaatgaacggtacgtttca
gtctgtcgtaagcattataaagaagcgctgagcgtcggctcattaacccaggtacaaaac
cagcaccgcccctgctaa

DBGET integrated database retrieval system