KEGG   Klebsiella quasipneumoniae: AVR78_22505Help
Entry
AVR78_22505       CDS       T04389                                 

Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kqu  Klebsiella quasipneumoniae
Pathway
kqu00564  Glycerophospholipid metabolism
kqu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kqu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AVR78_22505
Enzymes [BR:kqu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AVR78_22505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_oxidored FAD_binding_2 FAD_binding_3 DAO_C NAD_binding_8 Pyr_redox_2 Thi4 HI0933_like Pyr_redox 3HCDH_N GIDA Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AMR16941
UniProt: A0A2A5MJ77
LinkDB All DBs
Position
2204141..2205763
Genome map
AA seq 540 aa AA seqDB search
MTGRLDSEVIIIGGGATGAGIARDCARRGLRTLLIERHDIATGATGRNHGLLHSGARYAV
TDNESARECISENRILRRIARHCIEPAGGLFITLPEDDLAYQQTFIAACQQAGIEATPLS
AQEALRREPAVNPALLGAVQVPDGTIDPFRLTAANMLDAREHGAQILTGCEVTGLLRQGD
RVCGVQVYDSQLHQARTLYAGVVVNAAGIWGQRIAEYADLRITMFPAKGSLLILDHRINN
LVINRCRKPADADILVPGDTISLIGTTSMHIPYDEIDDNRVTTAEVDTLLREGEKLAPVM
GRTRILRAYSGVRPLVASDNDPSGRSVSRGIVLLDHAQRDGMEGFITITGGKLMTYRLMA
EWATDAVCRKLGNTTPCTTAESPLPGSQEPTESTLRKIISLPGPLRGSAVYRHGDRTPAW
LGDSRQHRSLVCECEAVTAGEVKYAVENLAVNTLLDLRRRTRIGMGTCQGELCACRAAGL
LQRFNVTTPAQSLAQLSAFLNERWKGVQPIAWGDALRESEFTRWVYLGLCGLPQEHQDEI
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgacgggacgtctggatagcgaggttattatcatcggcggcggcgcaaccggcgccggt
atcgcccgcgattgcgcccggcgcggattacgcacactgctcattgagcgtcatgatatc
gccaccggggccaccggccgtaatcatgggctgttgcacagcggcgcccgctatgcggtg
actgacaacgaatccgcccgcgaatgcatcagtgagaaccgcatcctgcgccgcatcgcc
cgtcactgtatcgaacctgccggcggtctgttcataaccctgcctgaagacgatctggca
tatcagcagacctttatcgccgcctgccagcaggctggcatagaggccacgccgctctct
gcgcaggaggcgctgcgccgcgagcccgccgtcaacccggcgctgctgggggcggtgcag
gttccggacggcaccattgacccgtttcgcctcaccgcggccaatatgctcgacgcccgc
gaacacggcgcgcagatcctcaccggctgcgaagtcactggcctgctgcgccagggcgat
cgcgtctgcggcgtccaggtatacgacagtcagcttcaccaggcccgcacgctgtacgcc
ggggtagtggttaatgccgccgggatctgggggcagcgcattgcggaatatgccgacctg
cgcatcaccatgttcccggcgaagggatcgctgttgatcctcgaccaccggattaacaac
ctggtgatcaaccgctgccgtaagccggccgatgccgatattctggtgcccggggatacc
atctcgctgatcggcaccacctcgatgcatattccttatgacgaaattgacgacaaccgg
gtcacgaccgcggaagtcgataccctgctgcgcgaaggcgaaaagctggcgccggtcatg
ggccgcacccggatcctccgcgcctactccggcgtccgcccgctggtggccagcgacaac
gatcccagcggacgcagcgtcagccgcggcatcgtcctgctcgatcatgctcagcgtgac
ggcatggaaggcttcattaccatcaccggcggcaagctgatgacctatcgcctgatggcc
gagtgggccaccgacgccgtctgtcgtaagctgggcaacaccaccccctgtaccacggcc
gagagcccgctgcccggctcacaggagccgacggaaagcaccctgcgaaaaattatctcc
ctgcctggcccgctgcgcggctctgccgtctaccgccatggcgatcgcactccggcctgg
cttggcgacagccgccagcaccgtagcctggtctgcgaatgcgaagccgtcaccgctggt
gaagtgaaatacgcggtggaaaatctggcggtcaacaccctgctcgacctgcgccgccgt
acccggattggcatggggacctgccagggggaactctgcgcctgccgcgccgccgggctg
ctgcagcgctttaacgtcaccacccccgcgcagtcgttggcccagctgtcggcgtttctc
aatgaacgctggaagggcgtgcagcccatcgcctggggcgacgcgctgcgcgaaagcgaa
ttcacccgctgggtctacctcggcctgtgcggactgccacaggagcatcaggatgaaatt
tga

DBGET integrated database retrieval system