KEGG   Klebsiella quasivariicola: B8P98_01675Help
Entry
B8P98_01675       CDS       T05116                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kqv  Klebsiella quasivariicola
Pathway
kqv00564  Glycerophospholipid metabolism
kqv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kqv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    B8P98_01675
Enzymes [BR:kqv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     B8P98_01675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_oxidored NAD_binding_8 FAD_binding_2 3HCDH_N Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: ASV18090
UniProt: A0A223U4X3
LinkDB All DBs
Position
complement(350573..352081)
Genome map
AA seq 502 aa AA seqDB search
MQTKDLIVIGGGINGAGIAADAAGRGLSVLMLEARDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGAESVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVRTRTRAISAKRENG
LWIVEAEDIDSGEKFTWKARGLVNATGPWVKQFFDEGMHLRSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPRAVAIDDKEINYLLNVYNAHF
KKPLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGQAPLLSVFGGKLTTYRK
LAEHALEKLTPYYKGIGPAWTKTAVLPGGDIGGDRDDYAAKLRRRFPFISEPLARHYART
YGSNSEWILKEASALSDLGEDFGHEFYEAELKYLVEHEWVRSLDDAIWRRTKQGMWLNAE
QQARISAWLAQHAGKSELSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaaccaaagatctgattgtgataggcggaggcattaacggtgccggtatcgcggca
gatgccgccgggcggggtttatccgtactgatgctggaagcgcgcgatcttgcctgcgcc
acctccagcgccagttccaaattgatccacggcggtctccgctacctcgaacactatgag
ttccgtctggtcagtgaagcgctggccgagcgtgaagtgctgttaaaaatggctccgcat
atcgctttcccgatgcgctttcgcctaccgcatcgcccgcatctgcgtccggcatggatg
atccgtatcggcttgtttatgtacgatcatctgggcaaacgcaccagcctgccgggatct
accgggttgcgttttggcgcagaatcggtgcttaagccggaaattgtgcgcggtttcgaa
tattcagactgctgggtcgacgatgcccgcctggtgctggccaacgcgcagatggtggtt
cgcaaaggcggcgaagtgcgcacccgcacccgcgccatctcggcaaaacgtgaaaatggg
ttgtggatcgtagaagcagaagatatcgatagcggcgagaagtttacctggaaggcgcgc
ggcctggttaatgccaccggcccatgggtcaaacagttcttcgacgaggggatgcatctg
cgttcgccttacggtatccgcctgatcaaaggcagccatattgtggtgccgcgggtgcat
acccagaagcaggcttatattctgcagaacgaagataaacgtattgtgtttgttattccg
tggatggatgaattctccatcatcggcacgacggacgtcgagtataagggtgacccgagg
gcggtagccattgatgataaagagatcaactacctgctcaacgtctataacgcgcacttt
aaaaagcccctcagccgggacgacatcgtctggacctattccggcgtgcgtccgctgtgt
gatgacgagtcggattcgccgcaggcgatcacccgtgactatacgctggatattcacgat
gagaacggccaggcgccgctgctctccgtcttcggcggcaagctgaccacctatcgcaag
ctggccgagcacgcgctggaaaaactgaccccctattacaaagggatcggtccggcgtgg
accaaaaccgcggtgctgcccggcggtgatatcggcggcgatcgcgacgactatgcggca
aaactgcgccgtcgcttcccgttcatcagtgaaccgctggcccgccattacgctcgcacc
tacgggagcaacagcgagtggatcctcaaggaagccagcgccctgagcgatctcggggag
gatttcggccacgagttttatgaagccgagctgaaatatctggttgagcacgaatgggta
cgcagcctggatgacgccatctggcgccgtactaaacagggaatgtggctgaatgccgag
cagcaggcgcgcatcagcgcgtggctggcgcagcatgcgggaaagtctgaactgtcttta
gcatcctga

DBGET integrated database retrieval system