KEGG   Klebsiella quasivariicola: B8P98_03030
Entry
B8P98_03030       CDS       T05116                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
kqv  Klebsiella quasivariicola
Pathway
kqv00052  Galactose metabolism
kqv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kqv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    B8P98_03030
Enzymes [BR:kqv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     B8P98_03030
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Methyltransf_25 TrkA_N 2-Hacid_dh_C 3HCDH_N MTS UDPG_MGDP_dh_N ELFV_dehydrog Methyltransf_31 PrmA Methyltransf_24 Methyltransf_11 Pyr_redox_2 CoA_binding Shikimate_DH Pyr_redox Met_10
Other DBs
NCBI-ProteinID: ASV18337
UniProt: A0A223U6A1
LinkDB
Position
complement(595187..596230)
AA seq 347 aa
MKSVVIHAEGNVCVEERPIPTLQTENDVLVKVVSSGLCGSDIPRIFAKGAHYYPITLGHE
FSGYVESYGAAVTDLQPGDAVACVPLLPCFQCPQCQREYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPDQMPIDDGAFIEPITVGLHAFHLAQGCEGKNVIIIGAGTIGLLALQCA
RELGANSVTAIDINPQKLELAKTLGATRVFNSREMNGQAIQQALEAIQFDQLVLETAGTP
QTVALAIEAAGPRAQLALVGTLHHDLTLPAATFGQILRKELNIVGSWMNYSGPWPGEEWQ
TATRLLTEKRLQLAPLIAHRGDAESFAREVQALNGAPMQGKILLKLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtaatccatgctgaggggaacgtctgcgttgaagaacgccctatccct
acgctgcaaacggaaaacgatgtcctggtcaaagtggtcagttccggtttatgcggctcc
gacatcccgcgcattttcgccaaaggcgcgcattactaccctattacgctgggacacgaa
ttcagcggctatgtggaatcctacggcgcggcggtaaccgacctgcagcccggcgatgcc
gtcgcctgcgtgccgctgctgccctgcttccagtgcccgcagtgccagcgcgagtatttc
tctttatgtaaacagtatcagttcgtcggctcacgcagcgaaggcggcaacgccgaatat
gtggtggtaaagcgtgccaacctgttccgcctgccggaccagatgccaattgatgacggc
gcgtttatcgaaccgataaccgttggcctgcacgctttccatctggcgcagggctgcgaa
ggtaaaaacgtgattattatcggtgccggcaccattggcctgctggcgctgcagtgcgcc
cgggaactgggcgccaacagcgtcacggcgatcgatatcaatccgcagaaactggaactg
gccaaaacccttggcgcaacccgtgtgttcaacagccgcgagatgaacggccaggcgatt
cagcaggcgctggaagccattcagttcgaccagttagtcctcgagaccgccggtacgccg
cagaccgtcgcattagcgattgaagccgccgggccgcgggcgcagctggcgctggtcggc
acgctccatcacgatttaaccctcccggccgccaccttcgggcagatcctgcgcaaggag
ttgaatattgtcggtagctggatgaactattctggcccgtggccaggagaagagtggcaa
acggccacccgcctgctgacagaaaaacgcctgcagctggcgccgctgatcgcccaccgc
ggtgacgcggagagctttgcgcgtgaagtgcaggcgctcaacggcgcgccgatgcagggc
aaaatcctgctcaaactctcctga

DBGET integrated database retrieval system