KEGG   Klebsiella quasivariicola: B8P98_08105Help
Entry
B8P98_08105       CDS       T05116                                 

Definition
(GenBank) fatty acid oxidation complex subunit alpha FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
kqv  Klebsiella quasivariicola
Pathway
kqv00071  Fatty acid degradation
kqv00280  Valine, leucine and isoleucine degradation
kqv00281  Geraniol degradation
kqv00310  Lysine degradation
kqv00362  Benzoate degradation
kqv00380  Tryptophan metabolism
kqv00410  beta-Alanine metabolism
kqv00640  Propanoate metabolism
kqv00650  Butanoate metabolism
kqv00903  Limonene and pinene degradation
kqv00930  Caprolactam degradation
kqv01100  Metabolic pathways
kqv01110  Biosynthesis of secondary metabolites
kqv01120  Microbial metabolism in diverse environments
kqv01130  Biosynthesis of antibiotics
kqv01200  Carbon metabolism
kqv01212  Fatty acid metabolism
Module
kqv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kqv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    B8P98_08105
   00650 Butanoate metabolism
    B8P98_08105
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B8P98_08105
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B8P98_08105
   00310 Lysine degradation
    B8P98_08105
   00380 Tryptophan metabolism
    B8P98_08105
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B8P98_08105
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    B8P98_08105
   00281 Geraniol degradation
    B8P98_08105
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B8P98_08105
   00930 Caprolactam degradation
    B8P98_08105
Enzymes [BR:kqv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     B8P98_08105
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     B8P98_08105
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     B8P98_08105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ASV19251
UniProt: A0A223U8F1
LinkDB All DBs
Position
1581803..1583947
Genome map
AA seq 714 aa AA seqDB search
MDAVSAFKLEVREDKVAVITIDAPGEKMNTLKAEFGNQVRGLIRQVRDDKSLRGVVFISA
KADNFIAGADINMIARCQSAQEAESLARQGQQIMSEIHGLSIPVIAAIHGACLGGGLELA
LACHARICSDDEKTRLGLPEVQLGLLPGSGGTQRLPRLIGVSTALDMMLTGRQLRARQAL
KAGLVDEVVPQAILLQAAVELALKGRPASRDMPVRERVLAGPLGRHLLFQFVGKQTQRKT
QGNYPAVKRILQVVENGLAHGCSSGYAEEARAFGELAMTPQSQALRSIFFASTDLKKDRG
AEAEPRPLTNIAVLGGGLMGGGIAYVTACKGGLPVRIKDIQPRGINHALKYSWDLLNKQV
RLRRLRPGERDRQMALISGATDYQGFAHRDVVIEAVFEDLALKQRMVSEVEQYGGKQTIF
ASNTSSLPIGDIAAHASRPEQVIGLHFFSPVEKMPLVEVIPHKGTDPQTIATVVQLAKRQ
GKTPIVVADKAGFYVNRILAPYINEAMRLLVEGEPVEVIDNALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLESAFGERFSPPANIIDAILKDDRKGRKNNRGFYLYETKGRKSKKRPDPA
VYPLLGIDRSPSRLSAQQVAERCVMMMLNEAARCFDERIIRSARDGDIGAVFGIGFPPFL
GGPFRYMDTIGAGEVAAILQRLAAQYGPRFTPCDTLLRMAEQGTTFWPADERLT
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgtttccgcttttaagcttgaggtccgtgaggacaaggtcgcggtgatcacc
atcgatgccccgggtgagaaaatgaataccctgaaagctgagttcggcaatcaggtgcgc
ggcttgatacgccaggttcgtgatgataagtcattgcgcggcgtggtgtttatctccgcc
aaagcggataactttatcgctggcgcagacattaacatgattgcccgctgccaaagcgcg
caggaggcggagtcgctggcgcgccagggacagcagattatgtctgagatccatggctta
tcgatcccggtgattgccgccatccacggcgcctgccttggtggtggtctggaactggcg
ctggcctgtcacgcccgcatctgtagcgatgacgaaaaaacccgactcggtttgccggaa
gtgcagcttggcctgctgccgggttccggcgggacacagcgtttaccgcggttgattggc
gtcagcaccgcgctggatatgatgctcaccggcaggcagctgcgtgcgcgacaggcgctg
aaagccggtctggtagacgaggtggtgccgcaggcgattttactgcaggcggcggtggag
ctggcgctgaaggggcgaccggccagccgggatatgccggtacgcgaacgcgtgctggcg
gggcctttgggccgccatctgttattccagtttgtcggcaaacaaacgcagcgtaaaacc
caggggaattatccggcggtgaagcgaattctgcaggttgtcgagaatggtctggcccac
ggctgcagcagcggttacgccgaagaagctcgcgcgtttggtgaactggcgatgaccccg
caatcgcaggcgcttcgctcaatcttctttgccagtaccgatctgaaaaaagatcgtggc
gccgaagcagagcccaggccgctgacgaacattgcggtgctgggcggcggcctgatgggc
gggggaatcgcctatgtgaccgcctgtaagggcgggctgccggtgcgcattaaagatatc
cagccgcgtggcatcaaccacgccttaaagtacagctgggatctgttgaataaacaggtt
cgcctgcgtcgtctgcgcccgggcgagcgcgatcgccagatggcgttgatctccggcgcc
acagactatcagggctttgctcatcgcgacgtggtgattgaggcggtatttgaggacctg
gctctcaaacagcggatggtcagcgaagtggaacaatacggtgggaagcagaccatcttt
gcgtcgaacacctcatcgttaccgatcggcgatattgccgcccacgccagccgtccggag
caggtaatcggcctgcatttttttagtccggtggagaaaatgccgctggtggaagtgatc
ccgcataagggaactgacccgcagactatcgccaccgtggtgcagctggctaaacggcag
ggaaaaacgccgattgttgtcgcagataaagcgggcttttatgtgaatcgcatactggcg
ccgtatatcaatgaagcgatgcgcctgctggtggaaggcgaaccggttgaggtgattgat
aacgcgttggttaaattcggttttccggtggggccgattcaactgctcgatgaggtgggt
atcgataccggcaccaaaattatccccgtgctggagagcgcgtttggagaacgttttagc
ccgcctgcaaacatcattgacgcgattttgaaggacgatcgcaaaggtagaaaaaataat
cgtggtttctatctttatgagacaaaagggcgtaaaagcaaaaaacggcccgacccggca
gtctatccgctgctgggcatcgaccgctccccgtcgcggctctccgcgcagcaggtggcg
gagcgctgtgtgatgatgatgcttaacgaggcggcgcgctgctttgatgagcgaattatc
cgcagcgcgcgcgatggcgatatcggcgccgtctttggtatagggtttccgccatttctt
ggcggcccgttccggtatatggatactatcggcgcgggtgaagttgccgcgatcctgcag
cgcctggccgcccagtacggcccacgttttacaccctgtgacactttgttacgcatggcc
gaacaggggacaaccttttggccagcggatgaacggctgacctaa

DBGET integrated database retrieval system