KEGG   Klebsiella quasivariicola: B8P98_08990Help
Entry
B8P98_08990       CDS       T05116                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
kqv  Klebsiella quasivariicola
Pathway
kqv00010  Glycolysis / Gluconeogenesis
kqv00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:kqv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B8P98_08990
   00500 Starch and sucrose metabolism
    B8P98_08990
Enzymes [BR:kqv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     B8P98_08990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: ASV19415
UniProt: A0A223U8Y6
LinkDB All DBs
Position
1772447..1773841
Genome map
AA seq 464 aa AA seqDB search
MKTFPADFLWGGATAANQVEGAYLEDGKGLSTSDVQPHGVFGEVVERVPGDNGIKDVAID
FYHRYPEDIALFAEMGFNCLRVSIAWTRIYPNGDDAEPNEAGLAFYDTLFDEMAKYNITP
LVTLSHYEMPWALVKNYGGWGSREVIGFFERYARTVFSRYKNKVKLWLTFNEINMSLHAP
MTGVGLPAGSSKGEVYQAIHHQLVASALAVKACHELVPEGKIGNMLLGGLMYPLSCKPED
VFETLQENRSWQFFGDVQARGAYPGYMQRYFRDNGITLTITDADREALKTTVDFISFSYY
MTGCVTADEALNQQARGNILSMVPNPHLASSEWGWQIDPLGLRTLLNVLWDRYQKPLFIV
ENGLGAKDKVEADGSIHDDYRISYLNDHLVQAREAIDDGVELMGFTSWGPIDLVSASKAE
LSKRYGFIYVDRHDDGTGTLARSKKKSFDWYKDVIASRGASLKA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattcccggcggattttttatggggcggcgcgactgcggcgaatcaggtggaa
ggggcttacctggaagatggcaaaggcttatccacctccgatgtgcagccgcacggcgtg
ttcggcgaagtggtcgagcgcgtacccggcgacaacgggattaaggatgtggcgatcgat
ttttaccatcgctatccggaagatattgccctgttcgctgagatgggcttcaactgcctg
cgggtgtccatcgcctggacccgcatctaccccaacggcgatgacgccgaaccaaacgaa
gccggcctcgcgttctacgacacgctgtttgacgagatggcgaagtacaacatcaccccg
ctggtgacgctgtcgcattacgaaatgccgtgggcgctggtgaaaaactacggcggctgg
gggagccgggaagtgattggcttctttgagcgctacgcccggacggtgttcagccgttat
aaaaataaggtcaaactgtggctgacctttaacgaaatcaatatgtcgctgcatgccccc
atgaccggggtcggtctgccggccggcagcagcaaaggcgaggtgtatcaggcgattcac
caccagctggtggccagcgccctagcggtcaaagcctgtcacgagctggtgcctgagggc
aaaatcggcaatatgctgctcggcgggctgatgtatcccctgagctgcaaaccggaggat
gtgtttgaaacgctgcaggagaatcgcagctggcagttctttggcgacgtgcaggcacgc
ggcgcgtatcccggctatatgcagcgctatttccgcgacaacggcattacgctcaccatc
accgacgccgatcgtgaagcgctgaaaaccaccgtcgactttatctctttcagctactac
atgaccggctgcgtcaccgccgacgaggcgctgaaccagcaggcgcgcggcaatattctc
agcatggtgccgaacccgcatctggcgagctcggagtggggctggcagatagatcctctc
ggtctgcgcacgctgctgaatgtgctgtgggatcgctatcagaaaccgctgtttatcgtg
gaaaacggtctgggcgccaaggataaggtggaagccgacggcagcattcacgatgactac
cgcatcagttacctgaacgaccatctggtgcaggcgcgggaagccattgacgatggcgtt
gagctgatgggcttcaccagctgggggccgattgacctggtgagcgcctcgaaggcagag
ctgtcgaagcgctacggctttatctatgtcgatcgccatgatgacggcaccggcaccctg
gcgcgcagtaagaagaagagttttgactggtataaggacgtgattgccagccgcggcgcc
agcctgaaagcgtaa

DBGET integrated database retrieval system