KEGG   Klebsiella quasivariicola: B8P98_17500Help
Entry
B8P98_17500       CDS       T05116                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
kqv  Klebsiella quasivariicola
Pathway
kqv00020  Citrate cycle (TCA cycle)
kqv00480  Glutathione metabolism
kqv01100  Metabolic pathways
kqv01110  Biosynthesis of secondary metabolites
kqv01120  Microbial metabolism in diverse environments
kqv01130  Biosynthesis of antibiotics
kqv01200  Carbon metabolism
kqv01210  2-Oxocarboxylic acid metabolism
kqv01230  Biosynthesis of amino acids
Module
kqv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kqv_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:kqv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B8P98_17500
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B8P98_17500
Enzymes [BR:kqv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     B8P98_17500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: ASV20959
UniProt: A0A223UD72
LinkDB All DBs
Position
complement(3470007..3471257)
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPAEGQKITLQNGKLNVPHNPIIPFIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEVYTGEKSTHVYGQDVWLPAETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSAEADKVIKFLR
DEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEGA
FKDWGYQLAREEFGGELIDGGPWVKIKNPNTGKEIVVKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMQWFEAADLIVKGMEGAIAAKTVTYDFERLMEGAKLLKCSEFGDAIIANM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagtagttccggcggaaggtcaaaaaatcaccctgcaaaacggcaaa
ctgaacgtcccgcataatccgattatcccgttcattgaaggtgatggtatcggcgttgac
gttaccccagcgatgctgaaagtggttgatgccgccgttgagaaagcctataagggcgag
cgtaaaatttcctggatggaagtttataccggtgagaaatcgacccacgtctatggccag
gacgtctggctgccagctgaaaccctcgatctgattcgtgactaccgcgttgctatcaaa
ggtcctctgaccactccagtcggcggcggcattcgttctctgaacgtagcgctgcgtcag
gagctggatctttacgtctgcctgcgtccggtacgttactaccagggcaccccgagcccg
gttaagcaccctgaactgaccgatatggttatcttccgtgaaaactcagaagatatctat
gccggtatcgagtggaaagccgactctgcggaagcagacaaagtgatcaaattcctgcgc
gatgagatgggcgtgaagaaaattcgcttcccggaacattgcggcatcggcatcaagccg
tgctctgaagaaggcaccaaacgcctggtgcgcgccgcgattgaatatgcgatcaccaac
gatcgtgattccgtcaccctggtgcacaaaggcaacatcatgaagttcaccgaaggcgcg
ttcaaagactggggctaccagctggctcgcgaagagtttggcggcgagctgatcgacggc
ggcccgtgggtgaaaatcaagaacccgaacaccggcaaagagatcgtggtaaaagacgtg
atcgccgatgcgttcctgcagcagatcctgctgcgtccggcggaatacgacgttatcgcc
tgtatgaacctgaacggcgactacatctctgacgccctggcggcacaggttggcggtatc
ggtatcgccccgggtgccaacattggtgacgaatgcgcgctgttcgaagcgactcacggt
actgcgccgaagtatgccggtcaggacaaagtgaacccgggctccatcatcctgtccgca
gagatgatgctgcgccacatgcagtggttcgaagccgcagacctgattgtcaaaggcatg
gaaggcgctatcgccgccaagaccgtgacctatgacttcgaacgtctgatggaaggcgct
aagctgctgaaatgttcagagtttggcgacgcgattatcgcgaacatgtaa

DBGET integrated database retrieval system