KEGG   Klebsiella quasivariicola: B8P98_20430Help
Entry
B8P98_20430       CDS       T05116                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kqv  Klebsiella quasivariicola
Brite
KEGG Orthology (KO) [BR:kqv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B8P98_20430
Enzymes [BR:kqv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     B8P98_20430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 FAD_oxidored Thi4 K_oxygenase NAD_binding_8 FAD_binding_3 Glutaredoxin FMO-like DAO NAD_binding_9 AlaDh_PNT_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ASV21486
UniProt: A0A223UEP8
LinkDB All DBs
Position
complement(4039179..4040744)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLAV
RKPSFLITNPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVFMNGQE
FGQGRMTLTEIVAKVDTGAEKRAAEELNQRDAYDVLIVGSGPSGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVNDYNVDVIDSQSATKLTPAATEG
GLHQIETASGAVLKARSVIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGVVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVTGLQYRDRVSGDEHHVALAGIFVQIGLLPNTTWLEGAVERNRMGEIIIDAKCETNV
KGVFAAGDCTTVPYKQIIIAAGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccaacatgaaaacccagctcaaggcctaccttgagaagctgaccaaacct
gttgagctgattgccacgctggatgacagcgctaaatcggcagagatcaaggaactgttg
gctgaaatcgctgaactgtcagataaagtcacttttaaagaagacaacacgctggcggta
cgtaagccgtctttcttaattaccaatcccggttccgaccagggcccgcgcttcgccggc
tctccgctgggccacgagtttacctcgctggtactggcgctgctgtggaccggcggccat
ccgtcgaaagaggcccagtcgctgctggagcagatccgcgatatcgacggtgattttgaa
tttgaaacctactactcgctctcctgtcataactgcccggacgtggtgcaggccctgaac
ctgatggcggtgctcaatccgcgcatcaagcacacggcgattgacggcgggacgttccag
aatgagatcaccgaacgcaacgtgatgggcgtgccggcggtattcatgaacggccaggag
tttggccaggggcggatgaccctgacggaaatcgtcgccaaagtggataccggcgcggaa
aaacgcgcagcggaagagctgaaccaacgtgacgcctatgatgtgctgatcgtcggctcc
ggcccgtccggcgcggcggcagcggtctactctgcgcgtaagggtatccgtaccggcctg
atgggcgagcgcttcggcggtcaggtgctggataccgtagatatcgaaaactatatttcg
gtaccgaaaaccgaaggccagaagctggccggcgcgctgaaagcgcacgtcaatgactat
aacgtcgatgtgatcgactcccaaagcgcgaccaaactgacgccggcggcgacagagggc
ggtctgcatcagattgaaaccgcctctggcgcggtgctgaaggcgcgcagcgtcatcatc
gccaccggcgccaaatggcgcaatatgaacgtgccgggcgaagatcagtatcgcaccaaa
ggcgtgacctactgcccgcactgcgatggtccgttgtttaagggcaaacgcgtagcggta
attggcggcgggaactccggcgtggaagcggccatcgacctggcaggcgttgtcgagcac
gtaaccctgctggagttcgctccagagatgaaagctgaccaggtgctgcaggataaggtc
cgcagcctgaagaatgtcgacatcattctcaatgcgcagaccacggaagtgaaaggcgat
ggcagcaaagtgaccggcctgcagtatcgtgaccgggtgagcggtgatgagcatcatgtt
gcgctggcgggcattttcgtccagatcggcctgctgccaaacaccacctggctggaaggc
gccgttgagcggaaccgtatgggtgagatcatcatcgatgcgaagtgcgaaaccaatgtc
aaaggcgtgttcgccgccggcgactgcaccactgtgccgtacaagcagattattatcgcg
gcaggggaaggggcaaaagcgtcgctgagcgccttcgactacctgatccgcacgaaaacc
gcataa

DBGET integrated database retrieval system