KEGG   Klebsiella quasivariicola: B8P98_27375Help
Entry
B8P98_27375       CDS       T05116                                 

Definition
(GenBank) permease
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kqv  Klebsiella quasivariicola
Pathway
kqv00010  Glycolysis / Gluconeogenesis
kqv00030  Pentose phosphate pathway
kqv00051  Fructose and mannose metabolism
kqv00052  Galactose metabolism
kqv00680  Methane metabolism
kqv01100  Metabolic pathways
kqv01110  Biosynthesis of secondary metabolites
kqv01120  Microbial metabolism in diverse environments
kqv01130  Biosynthesis of antibiotics
kqv01200  Carbon metabolism
kqv01230  Biosynthesis of amino acids
kqv03018  RNA degradation
Module
kqv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kqv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B8P98_27375
   00030 Pentose phosphate pathway
    B8P98_27375
   00051 Fructose and mannose metabolism
    B8P98_27375
   00052 Galactose metabolism
    B8P98_27375
  09102 Energy metabolism
   00680 Methane metabolism
    B8P98_27375
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    B8P98_27375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:kqv01009]
    B8P98_27375
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:kqv03019]
    B8P98_27375
Enzymes [BR:kqv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     B8P98_27375
Protein phosphatases and associated proteins [BR:kqv01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     B8P98_27375
Messenger RNA biogenesis [BR:kqv03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     B8P98_27375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ASV22728
UniProt: A0A223UI88
LinkDB All DBs
Position
complement(5449244..5450224)
Genome map
AA seq 326 aa AA seqDB search
MKIGIVISGGDVSGMNNFIFQIARQANADITLFNGGIPGLLEKSHQDMAWRDLVDYSITA
VPIITSGRTSRKLQRSEYESIAKKLKSLRIDVLIMAGGDGSLQFLNTLSEFEINCFGVGM
TIDNDVYGSDYTIGFSTACEQIIKEVSRLRNTGRALPGRVFMVEILGGYCGELTLQSAIK
CNADIALIPEAQMPLAVLAERITRKLSTQNSVVILCSEGYTKEYSPGFQGAIDTMIKQLE
PQIGVRIRKTIVGYGLRSGDPTCEEIYQGTIMASEVVRCIQSGMKNKAIIINSSNKPIPI
DLVSMKKRLVDTEGHHYKLAKQLNII
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggtatcgttattagcggcggggatgtttctggaatgaataattttatattc
cagatagccaggcaggctaatgccgatatcacgctgtttaatggcggtattccagggcta
ctggagaaaagtcatcaggatatggcgtggcgcgatctggttgattattcaattaccgcg
gtgccgatcattacctcggggcgaaccagtcgcaaactgcagcgcagtgaatatgaaagc
attgctaaaaaacttaaatctctgcgtattgatgtgctcattatggccgggggggatggc
agcctgcagtttctgaatacccttagtgaatttgagattaattgctttggtgtgggaatg
actatcgataatgatgtgtatggcagtgattatacgattggtttttccacggcctgtgag
caaattattaaagaagtctctcgtttaagaaataccggaagagcgctgcccggtcgggtt
tttatggttgagatattaggaggctattgtggagaactaacgttgcagtccgccattaaa
tgtaatgcggatattgccctgatcccggaggcacagatgccgttggccgtgctcgcggaa
cggattacccggaagctgagtacgcagaatagcgtcgttatcctctgctcagaaggctat
accaaagagtactctcccggctttcagggggcgattgataccatgattaaacagctggaa
ccacaaataggtgtccgtatccgtaaaacgatcgtcggctatggtttacgcagcggtgat
ccaacctgcgaagagatttatcagggcactattatggccagtgaagtggttcgctgtatt
cagtcaggtatgaaaaataaagccataataattaattccagtaacaaacctattccgatt
gatttagtcagtatgaaaaaacgtctggtcgatactgaaggacatcattataaacttgcc
aagcaactcaatattatttga

DBGET integrated database retrieval system