KEGG   Kineococcus radiotolerans: Krad_0621Help
Entry
Krad_0621         CDS       T00562                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00010  Glycolysis / Gluconeogenesis
kra00052  Galactose metabolism
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
kra01120  Microbial metabolism in diverse environments
kra01130  Biosynthesis of antibiotics
Module
kra_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Krad_0621
   00052 Galactose metabolism
    Krad_0621
Enzymes [BR:kra01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Krad_0621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABS02110
UniProt: A6W5M1
LinkDB All DBs
Position
complement(1657819..1658985)
Genome map
AA seq 388 aa AA seqDB search
MPLNPSRRSVVLAGAAATALVGAAAAPAAAAVQREPRLFAEPWGTLPDGTAVERWTLVDG
EVTARILTYGGILQSLEFPDHRGRVRNVVLGFADLEGYLAGNNPGPYFGALIGRYGNRIA
GGRFTLDGVEHQLPLNNGPNSLHGGTDSFDKRVWSATPVFGDGTVGLRLSLDSPDGDQGY
PGNLHVEVTYTLDRFAQLTLDYLATTDAATVVNLTNHSYWNLAGEGSGTALDHELTIHAD
GFTPVDETLIPTGEIAPVAGTPMDFRSPRRIAARIRQPYQQILFGQGYDHNWVLDRAGDG
LEEAAVLHDPRSGRTLRVSTTEPGLQFYSGNFLDATLVGTGGGVYRQGDGVALETQHFPD
SPNQPDFPSTVLRPGEEYRSTTVFGLSR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcaacccctcccggcgcagcgtcgtgctggccggcgcggcggccaccgccctc
gtcggcgcggccgccgcccccgcggccgccgcggtccagcgcgaaccccggttgttcgcc
gaaccgtggggcaccctgcccgacgggaccgccgtcgagcgctggaccctcgtcgacggc
gaggtcaccgcgcggatcctgacctacggcgggatcctgcagagcctggagttccccgac
caccggggccgggtccgcaacgtcgtcctcggcttcgccgacctcgagggctacctcgcg
ggcaacaaccccggcccgtacttcggggcgctcatcggccgctacggcaaccggatcgcg
ggcgggaggttcaccctcgacggcgtcgagcaccagctgcccctgaacaacggcccgaac
agcctgcacgggggcaccgactccttcgacaagcgggtgtggtcggcgacaccggtgttc
ggtgacggcaccgtcggtctccggctgtccctggacagccccgacggcgaccagggctac
cccgggaacctgcacgtcgaggtgacgtacaccctggaccggttcgcgcagctgaccctg
gactacctcgccaccaccgacgccgcgacggtggtgaacctcaccaaccacagctactgg
aacctggccggtgaggggtccggcaccgccctcgaccacgagctgaccatccacgccgac
ggtttcacccccgtcgacgagacgctcatcccgaccggtgagatcgccccggtggcgggg
accccgatggacttccgctccccgcggcggatcgcggcgcggatccgccagccctaccag
cagatcctcttcggccagggctacgaccacaactgggtgctggaccgggccggggacggg
ctggaggaggccgcggtcctgcacgacccccgcagcgggcgcaccctgcgggtgtcgacg
acggaaccggggttgcagttctactcggggaacttcctcgacgccaccctcgtcggcacc
ggcggcggggtctaccgccagggcgacggggtggcgctggagacccagcacttcccggac
tccccgaaccagccggacttcccctccaccgtgctgcgaccgggggaggagtaccgctcc
acgacggtgttcgggctctcgcgctga

DBGET integrated database retrieval system