KEGG   Kineococcus radiotolerans: Krad_0653Help
Entry
Krad_0653         CDS       T00562                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ABS02142
UniProt: A6W5Q3
LinkDB All DBs
Position
1624955..1626016
Genome map
AA seq 353 aa AA seqDB search
MGAVDLPVNPPVEPMLAKAASGLPPQPDGDPAWLYEPKWDGFRCVVFRDGEEVELSSRNG
RGLTRYFPEVVAAVRAELPERCVVDGELFVPGPGGGRLSWDLLSQRIHPAASRVELLAVE
TPAQFVAFDLLALGGEDLTGASTAVRRERLETALAGCGPTTHVTTATRDADVAARWFTTF
EGAGLDGVVAKPLDSPYLPGERVMTKVKHRRTADCVVVGYRLHKSFPGIGSMLLGLRTDE
GTAFVGGAAAFTKPRRVELLEQLSALRTGEENAEGEKNRWNAREDNSWVPVRQELVCEVE
YDQLEGLRFRHNPRFLRWRPDKTPEECRLDQLDVPADYDLADVLSGASRAGAA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgggggccgtggacctgccggtgaacccgcccgtcgagccgatgctggccaaggcggcc
tccgggctgccgccgcagcccgacggcgacccggcctggctctacgagcccaagtgggac
gggttccggtgcgtggtgttccgcgacggcgaggaggtcgagctcagctcccgcaacggg
cgggggctgacgcggtacttccccgaggtcgtcgcggccgtgcgggccgagctgcccgag
cggtgcgtcgtcgacggcgagctgttcgtccccggtcccggtgggggccggctgtcgtgg
gacctgctctcccagcgcatccaccccgccgccagccgggtcgagctgctcgccgtggag
accccggcgcagttcgtcgccttcgacctgctcgccctgggcggggaggacctcaccggg
gcctcgaccgcggtgcgccgcgagcggctggagacggcgctcgccgggtgcggtcccacc
acccacgtcacgacggccacccgcgacgccgacgtcgcggcgcggtggttcaccacgttc
gagggcgccggcctcgacggggtcgtcgcgaaacccctggactccccctacctcccgggc
gaacgggtcatgacgaaggtgaagcaccgccgcaccgccgactgcgtcgtcgtggggtac
cgcctgcacaagagcttccccgggatcgggtcgatgctgctggggctgcggaccgacgag
gggaccgcgttcgtggggggcgcggcggcgttcaccaagccccgccgggtggagctgctg
gagcagctgtcggcgctgcggacgggcgaggagaacgccgagggcgagaagaaccggtgg
aacgcccgcgaggacaactcctgggtcccggttcgccaggaactggtctgcgaggtcgag
tacgaccagctggaggggctgcggttccgccacaacccgcggttcctgcgctggcggccg
gacaagacccccgaggagtgccgcctcgaccagctcgacgtccccgccgactacgacctc
gccgacgtcctgtccggggcctcgcgggcaggtgcggcgtga

DBGET integrated database retrieval system