KEGG   Kineococcus radiotolerans: Krad_1419Help
Entry
Krad_1419         CDS       T00562                                 

Definition
(GenBank) phosphatidate cytidylyltransferase
  KO
K00981  phosphatidate cytidylyltransferase [EC:2.7.7.41]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00564  Glycerophospholipid metabolism
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Krad_1419
Enzymes [BR:kra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.41  phosphatidate cytidylyltransferase
     Krad_1419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_1 CarS-like
Motif
Other DBs
NCBI-ProteinID: ABS02907
UniProt: A6W7W8
LinkDB All DBs
Position
complement(803367..804230)
Genome map
AA seq 287 aa AA seqDB search
MTGHPATTDPPRRAGRNLPAAVGIGLGLGAAVVASLFIRPEAFVVFATVAVLYGSVEVVR
AFRSRHLRVPVLPPVVGTLAMLPGAYLGGGETLLVAYVLTVFAVLAHRLLGDGGDHGSPV
PVPAVRDVAGGLFVVSYVPLLAGFAMLMLAASDGPWRVLVFVLLVVASDVGGYATGVLWG
RHPMAPSVSPKKSWEGTAGSLAVGAVTGAIALPLALDGSWWGGALLGLVTVVVAVLGDLS
ESMLKRDLGIKDMGTLLPGHGGVMDRLDSLLPAAPVVHLLLLVLVGS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggccaccccgccaccaccgacccgccgcggcgggcgggacgcaacctccccgcc
gccgtcggcatcggactcggtctcggggccgccgtcgtcgccagcctgttcatccgcccg
gaggcgttcgtcgtcttcgcgaccgtcgccgtcctctacggcagcgtcgaggtggtgcgg
gccttccgctcgcgccacctgcgggtgccggtgctgccgccggtggtcgggaccctcgcg
atgctgccgggggcctacctcggcggcggggagaccctcctcgtcgcctacgtcctcacc
gtcttcgccgtcctcgcccaccggttgctcggggacggcggcgaccacggttccccggtg
ccggtcccggccgtgcgcgacgtcgccggcgggctcttcgtcgtcagctacgtccccctg
ctggccgggttcgcgatgctcatgctcgccgcgagcgacggcccctggcgcgtcctcgtg
ttcgtgctcctcgtcgtggccagcgacgtcggcgggtacgcgaccggggtgctgtggggc
cggcacccgatggccccctcggtcagccccaagaagtcgtgggaggggaccgcggggtcc
ctcgcggtcggggcggtgaccggggcgatcgcgctgccgctggcgctggacgggtcctgg
tggggcggggcgctcctggggctggtcaccgtggtggtcgcggtcctgggcgatctgtcg
gagtcgatgctcaagcgcgacctcgggatcaaggacatgggcaccctgctgcccggtcat
ggcggggtgatggaccgcctggactcgctgctgccggccgcgccggtcgtgcacctgctg
ctgctggtgctcgtcgggtcctga

DBGET integrated database retrieval system