KEGG   Kineococcus radiotolerans: Krad_1615Help
Entry
Krad_1615         CDS       T00562                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase (NAD(P)(+))
  KO
K00057  glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC:1.1.1.94]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00564  Glycerophospholipid metabolism
kra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Krad_1615
Enzymes [BR:kra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.94  glycerol-3-phosphate dehydrogenase [NAD(P)+]
     Krad_1615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_Gly3P_dh_N NAD_Gly3P_dh_C F420_oxidored ApbA
Motif
Other DBs
NCBI-ProteinID: ABS03101
UniProt: A6W8G2
LinkDB All DBs
Position
complement(588945..589913)
Genome map
AA seq 322 aa AA seqDB search
MAGVHVAVLGSGAWGTAVAGLLAANASSVGLWCRRPELAERIRVSGRNEQYLPGIDLPAR
VHAGSRVEDVVEGAELVVLAVPLQRLRSLLLRWREVLPAVPVVNLAKGVETSTGLFGSEV
VADVLDGRPVLALSGPNLALEIARGQPAATVVACVDAEVAGRVATWCSTPDFHAHPLTDV
VGVDVAGAVKNVVALAVGMVEGAGLGANARAAVTTLGLTETAELGRRLGARLETFLGLAG
AGDLVATSTSTLSRNHRVGVALGEGLPLAEALVRAGGTAEGVATAPALLRRDPDLPFVRD
VVAVLDGQRSPVEAVTRLLTVA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggtgtgcacgtcgccgtcctcgggtccggagcgtggggaacggccgtcgccggg
ctcctcgccgccaacgccagcagcgtcgggctgtggtgccgccggcccgagctcgccgag
cgcatccgggtctcggggcgcaacgagcagtacctgccggggatcgacctgcccgcccgc
gtccacgcggggtcccgcgtcgaggacgtcgtggagggcgcggagctggtggtcctcgcg
gtgccgctgcagcggctgcggtccctgctcctgcgctggcgggaggtgctgcccgccgtc
ccggtggtgaacctggccaagggcgtggagacctcgacggggctgttcggctccgaggtc
gtcgccgacgtcctggacggccggcccgtcctggcgctgtcggggcccaacctcgccctg
gagatcgcccgcggtcagcccgccgccaccgtcgtggcctgcgtggacgcggaggtggcc
gggcgggtcgcgacctggtgcagcacaccggacttccacgcccacccgctgaccgacgtc
gtcggcgtcgacgtcgcgggggcggtgaagaacgtcgtcgcgctggccgtggggatggtg
gagggcgcgggtctgggcgcgaacgcgcgggccgcggtgacgaccctggggctcaccgag
accgcggagctgggccggcgcctcggggcgcggctggagacgttcctgggcctggccggc
gccggggacctcgtcgccaccagcacctccacgctctcgcgcaaccaccgcgtcggggtg
gcgctgggggaggggctgccgctggccgaggcgctggtccgcgcgggcggcaccgcggag
ggcgtcgcgacggccccggcgctgctgcggcgcgacccggacctgccgttcgtgcgcgac
gtcgtggccgtcctcgacgggcagcgctcacccgtcgaggcggtcacccggctgctgacg
gtggcctga

DBGET integrated database retrieval system