KEGG   Kineococcus radiotolerans: Krad_1884Help
Entry
Krad_1884         CDS       T00562                                 

Definition
(GenBank) diacylglycerol kinase catalytic region
  KO
K07029  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00561  Glycerolipid metabolism
kra00564  Glycerophospholipid metabolism
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Krad_1884
   00564 Glycerophospholipid metabolism
    Krad_1884
Enzymes [BR:kra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     Krad_1884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABS03370
UniProt: A6W981
LinkDB All DBs
Position
complement(344586..345467)
Genome map
AA seq 293 aa AA seqDB search
MNPTAGRGGGRVAGAHVLATLQRLGHRVTDLTGSDLAASSRAARERAGELDALVVVGGDG
LVHAALGAVAGTPTALGIVPAGTGNDLARGLGLPLGDPARAAGLVSSALREGRHRAVDAV
RVRGAARSSWYGSVLASGVDALVNERANSWRWPRGPARYTLAALRELAVVSGVGMRITLD
GEVQERDCLLVAVANTPCYGGGMRMAPHADPTDGLLDVVVVDAMPRLAALRLLPRVRRGA
HLDVAAVHVHRARSVTLEALPGGREPHPHADGEPLEHLPLTCDVVPGALRVLA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtgaacccgacggcgggtcgcgggggcggtcgcgtcgcgggggcgcacgtcctcgcgacg
ctgcagcggctcgggcaccgcgtcaccgacctcaccgggtccgacctcgccgcctcctcc
cgcgccgcgcgcgagcgcgccggggagctggacgccctcgtcgtcgtggggggcgacggt
ctggtgcacgccgccctgggggccgtcgccgggacccccacggccctgggcatcgtcccc
gccggcaccggcaacgacctggcccgcggcctgggcctgcccctgggcgaccccgcccgc
gccgcgggcctcgtctccagcgccctgcgcgaggggcgccaccgcgccgtcgacgccgtc
cgggtgcgcggggccgcccggtccagctggtacggcagcgtcctcgcctccggcgtcgac
gccctggtcaacgagcgcgccaactcctggcgctggccccgcggcccggcccgctacacc
ctggccgcgctgcgcgagctcgcggtggtgagcggggtggggatgcgcatcaccctcgac
ggggaggtccaggagcgcgactgcctgctcgtggccgtcgccaacaccccctgctacggg
ggcgggatgcggatggccccgcacgccgaccccaccgacggcctgctcgacgtggtcgtc
gtcgacgcgatgccgcggctggccgcgctgcgcctgctgccccgggtccggcgcggggcg
cacctcgacgtcgccgccgtccacgtccaccgggcgcgcagcgtgaccctggaggcgctg
cccggcgggcgcgagccccacccccacgccgacggcgagccgctggagcacctgcccctc
acctgcgacgtcgtcccgggcgcgctgcgcgtcctcgcctga

DBGET integrated database retrieval system