KEGG   Kineococcus radiotolerans: Krad_1894Help
Entry
Krad_1894         CDS       T00562                                 

Definition
(GenBank) glycerophosphoryl diester phosphodiesterase
  KO
K01126  glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Krad_1894
Enzymes [BR:kra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     Krad_1894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDPD GDPD_2 SDH_sah
Motif
Other DBs
NCBI-ProteinID: ABS03380
UniProt: A6W991
LinkDB All DBs
Position
331863..332663
Genome map
AA seq 266 aa AA seqDB search
MVPRPPARTAFCTWRGPIAMAHRGFAATPELAGLENSLPAFAAAVDLGYRYLETDVRASA
DGVLVAFHDERLDRVTDARGELAALPWSRLRAVRIAGREPVPRLEDVLGSFPAARFNLDV
KTAAAVPGLAEVLRRTRAHGRVLVTAFAEDRRRAALAAVGGAEATSAGSRATALALAGVK
LGSDALVRRALAGVDAVQVPVRHGGVEVVSRRFVDAVHRAGAQVHVWTVDDALQVGALLD
LGVDGIITDRADVLREVLLARGQWVS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggtgccccggccgccggcccgcaccgcgttctgcacctggcgggggccgatcgcgatg
gcccaccgggggttcgccgcgaccccggagctggccgggctggagaactccctgccggcc
ttcgccgccgccgtggacctggggtaccgctacctggagaccgacgtccgcgccagcgcc
gacggggtcctcgtcgccttccacgacgaacggctggaccgggtcaccgacgcccgcggc
gagctcgccgccctgccctggtcgcgcctgcgggcggtgcgcatcgccgggcgcgaaccc
gttccccgcctcgaggacgtcctggggtccttccccgcggcccgcttcaacctcgacgtc
aagaccgccgcggccgtccccggcctggcggaggtgctgcggcgcacccgcgcccacggc
cgggtcctcgtcaccgccttcgccgaggaccgccgccgcgccgcgctcgccgccgtcggc
ggggccgaggcgacctcggcgggctcgcgcgccaccgccctcgccctggccggggtgaag
ctggggtccgacgccctggtgcgccgggcgctggccggggtcgacgccgtgcaggtcccc
gtgcgccacggcggggtggaggtcgtctcgcggcgcttcgtcgacgccgtgcaccgcgcc
ggagcgcaggtccacgtctggaccgtcgacgacgccctccaggtgggggcgctgctcgac
ctgggcgtggacgggatcatcaccgaccgcgccgacgtcctgcgcgaggtcctgctggcc
cgggggcagtgggtctcgtga

DBGET integrated database retrieval system