KEGG   Kineococcus radiotolerans: Krad_2224Help
Entry
Krad_2224         CDS       T00562                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00010  Glycolysis / Gluconeogenesis
kra00071  Fatty acid degradation
kra00350  Tyrosine metabolism
kra00625  Chloroalkane and chloroalkene degradation
kra00626  Naphthalene degradation
kra00680  Methane metabolism
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
kra01120  Microbial metabolism in diverse environments
kra01130  Biosynthesis of antibiotics
kra01200  Carbon metabolism
kra01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Krad_2224
  09102 Energy metabolism
   00680 Methane metabolism
    Krad_2224
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Krad_2224
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Krad_2224
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Krad_2224
   00626 Naphthalene degradation
    Krad_2224
Enzymes [BR:kra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Krad_2224
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     Krad_2224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C Pollen_allerg_1 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ABS03705
UniProt: A6WA66
LinkDB All DBs
Position
complement(4759892..4761037)
Genome map
AA seq 381 aa AA seqDB search
MPTSKPSGDQTMLAAVLSPDSAEFVLERVPVPAPRAGEALIRVAACGVCHSDLHVLKGEI
AFPRPAVLGHEISGTIVQLGDGVENLRVGDAVVGGFIMPCTRCDECQRGRDDLCPQFFAQ
NRLKGALFDGETRLRRTDGSPLAMYSMAGLAEYSVCPVSALAVLPSEVSMTSAAVLGCAG
MTAYGAVHRAGSVQPGATVAVVAVGGLGMSMVQLAAAAGASTVVAVDVNDEKLAMARRLG
ATHTVNSAKEDAHAAVRAATGGRGVDVAIEALGRPATLRLAVDVLADGGRAVAVGLAAGN
AEVGIEITPFVRRSRSLMGSFGARTRTDLPAVVDLAARGSFDPDALVTDVFSLEDVNEAY
SRLDGGDILGRAVVSMGSSLS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgtcgaagccaagcggagatcaaacgatgctcgcggcggtgttgtcgcccgac
agtgctgagttcgtccttgagcgggttccggttcctgcgccccgcgccggggaagcgctg
atccgtgttgcggcgtgcggagtctgtcactccgacttgcatgtactcaaaggcgagatt
gcgttcccccgccccgcggtgctgggtcacgagatcagcggcaccatcgtgcagctcggt
gacggcgtcgaaaacctccgagttggagacgccgtcgtcggggggttcatcatgccgtgc
acccggtgcgatgagtgtcagcgaggccgcgatgacctgtgtccgcaattcttcgcccag
aaccggttgaagggcgctttgttcgacggtgaaacccgcctgaggcgcacggacgggtca
ccgctggccatgtactcgatggcgggtctcgccgagtactcggtgtgcccggtgagtgcc
ttggcggttctcccgtcagaagtgtcgatgacaagtgccgctgtgctggggtgtgccggg
atgaccgcgtacggagccgtccaccgcgccggcagcgtccaacccggcgcgacggttgcc
gtggtcgcagtgggtggactaggcatgtccatggttcaactcgccgcggcggcgggggcg
tcgacggtggtagcggtcgacgtcaacgacgagaagcttgcgatggctcgtcgtctaggg
gctacgcacacggtcaactcagcgaaggaagacgcgcacgctgcggtgcgagcggcgacc
ggtggccggggagtggacgtggcgatcgaagctctgggccgtccggccacgctgcggctg
gcggtcgatgtactggccgacggcggccgggcggttgcggtcggactggcagcggggaac
gcggaagtcggcatcgagatcacccctttcgtccggcgcagccgctcgctcatgggttcc
ttcggagcccggacacgtaccgatctgccggcggtggtcgaccttgccgcccgtggctcg
ttcgatcctgacgcgcttgtcactgacgtgttctctttggaagacgtcaacgaagcctat
tcacgcttggacggtggcgacatcctcgggcgggctgtggtgtcgatggggtcgtcgttg
tcctga

DBGET integrated database retrieval system