KEGG   Kineococcus radiotolerans: Krad_3101Help
Entry
Krad_3101         CDS       T00562                                 

Definition
(GenBank) CDP-alcohol phosphatidyltransferase
  KO
K08744  cardiolipin synthase (CMP-forming) [EC:2.7.8.41]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00564  Glycerophospholipid metabolism
kra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Krad_3101
Enzymes [BR:kra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.41  cardiolipin synthase (CMP-forming)
     Krad_3101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf
Motif
Other DBs
NCBI-ProteinID: ABS04565
UniProt: A6WCM6
LinkDB All DBs
Position
3901454..3902035
Genome map
AA seq 193 aa AA seqDB search
MVASGHVVSDRVLTIPNGLSLLRLLLLPVFAVLILGGRDGWALLVLVVSSASDYLDGNLA
RRWNQVTRLGQVLDPFADRLYILTTLLGLAHRDLVPWWLVVVLLARDLVLVATVPVLARM
GHTVLPVHFLGKAGTFCLLGAFPLLLLAEVSTTLAGPAGAVGWALALWGTGLYWWAGVLY
LVQLVRLRRSERP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtggtggcgagcgggcacgtcgtcagcgaccgcgtgctcacgatccccaacggcctcagc
ctcctgcggctgctgctgctgccggtcttcgccgtcctgatcctgggcggccgcgacggg
tgggccctgctcgtcctcgtcgtcagcagcgccagcgactacctcgacggcaacctggcc
cggcgctggaaccaggtgacccgcctggggcaggtgctggaccccttcgccgaccggctc
tacatcctcaccaccctgctgggcctggcccaccgcgacctcgtcccctggtggctcgtg
gtcgtgctgctcgcccgcgacctcgtcctggtggcgacggtgcccgtgctggcccggatg
ggtcacacggtgctgcccgtgcacttcctgggcaaggccggcacgttctgcctgctcggc
gccttcccgctgctgctgctggcggaggtgtcgaccaccctggccgggcccgccggcgcg
gtgggctgggccctggcgctgtggggcaccgggctgtactggtgggccggggtcctctac
ctcgtccagctcgtgcggctgcggcggagcgagcgcccgtga

DBGET integrated database retrieval system