KEGG   Kineococcus radiotolerans: Krad_3116Help
Entry
Krad_3116         CDS       T00562                                 

Definition
(GenBank) phospholipid/glycerol acyltransferase
  KO
K00655  1-acyl-sn-glycerol-3-phosphate acyltransferase [EC:2.3.1.51]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00561  Glycerolipid metabolism
kra00564  Glycerophospholipid metabolism
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Krad_3116
   00564 Glycerophospholipid metabolism
    Krad_3116
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:kra01004]
    Krad_3116
Enzymes [BR:kra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     Krad_3116
Lipid biosynthesis proteins [BR:kra01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   Krad_3116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyltransferase DAGAT
Motif
Other DBs
NCBI-ProteinID: ABS04580
UniProt: A6WCP1
LinkDB All DBs
Position
3885738..3886493
Genome map
AA seq 251 aa AA seqDB search
MNRAPVGGEHPGPPQAWTRAVGKLLAHGVWNARVLGAENVPTTGPVLFAANHASIVDGPL
LYGVTPRRAHFLVKKEMFEGSLLTRFVGGALLQAGQIPIDRTRGDRDALQSVLAVLAAGG
AAGVFPEGTRGRGDAASVRSGIAWIALQSGAPVVPVACLGAHLRGEPPRSLPPLRRKLTF
CFGEPFTVVKEPGVPGRTALANAVERVRVELSSHVLDSLQRTGIQLPEDQDGADELGLGE
MTSDDVPGGTR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgggccccggtgggcggggagcaccccggcccgccgcaggcctggacccgggcg
gtcgggaagctcctcgcccacggcgtctggaacgcccgcgtcctgggtgcggagaacgtg
cccaccaccggtccggtcctcttcgcggccaaccacgcctcgatcgtggacgggccgctg
ctgtacggcgtgaccccgcggcgggcgcacttcctcgtcaagaaggagatgttcgagggc
tcgctgctgacgcgcttcgtcgggggggccctgttgcaggccggtcagatccccatcgac
cgcacccgcggcgaccgcgacgcgctgcagtcggtgctggcggtcctcgccgccggcggg
gcggcgggggtcttccccgaggggacccgcgggcgcggcgacgcggccagcgtgcgcagc
ggcatcgcctggatcgcgctgcagtccggcgcccccgtggtgcccgtcgcctgcctcggc
gcccacctgcgcggcgagcccccccggtcgctgccgcccctgcggcgcaagctgacgttc
tgcttcggcgaacccttcacggtcgtcaaggaacccggggtgcccgggcggaccgccctg
gccaacgccgtcgaacgcgtccgggtggagctgtccagccacgtgctggactccttgcag
cgcaccggcatccaactacccgaagaccaggacggcgccgacgagctggggctcggcgag
atgacgtccgacgacgtgccaggaggcacccggtga

DBGET integrated database retrieval system