KEGG   Kineococcus radiotolerans: Krad_3700Help
Entry
Krad_3700         CDS       T00562                                 

Definition
(GenBank) carbohydrate kinase, YjeF related protein
  KO
K17758  ADP-dependent NAD(P)H-hydrate dehydratase [EC:4.2.1.136]
Organism
kra  Kineococcus radiotolerans
Brite
KEGG Orthology (KO) [BR:kra00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Krad_3700
Enzymes [BR:kra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.136  ADP-dependent NAD(P)H-hydrate dehydratase
     Krad_3700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carb_kinase HK Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ABS05163
UniProt: A6WEC4
LinkDB All DBs
Position
complement(3221336..3222235)
Genome map
AA seq 299 aa AA seqDB search
MTNTADRAVTVTSAVLRDWPLPPPGTGKESRGRTIVVGGSTRTPGAVLLAAESALRCGAG
KLQVATTRSTAPAMGVAVPEALVLPLPETGGGGIDPACAAEGGELVDLVRNAHAALLGVG
AVDEPDVRALLEQLVPGLGNVVVLDALGLAPVTADVTFLHHLQGSAVLTPNLAELAIVLG
AEPEEVEADVASAAVELARRSRCAVAAGGGESWIAAPDGRLWRDSSGGAGLGVSGSGDVL
SGIVTGLCARGADPVQAAVWACHLHGRAGDRLASSVGRLGFLARELPAQVPAVLAEIEV
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacaccgctgaccgggccgtgaccgtgacctccgcggtcctgcgggactggccg
ttgcccccgccgggcacggggaaggagtcgcgcgggcgcacgatcgtggtgggcggcagc
acccgcacccccggtgcggtgctgctggccgcggagtccgcgctgcggtgcggggcgggc
aagctgcaggtcgccacgacccgctccacggcccccgcgatgggcgtggccgtccccgag
gcgctggtgctgccgctgccggagaccgggggcgggggaatcgacccggcgtgcgccgcg
gagggcggggaactggtggacctggtccgcaacgcccacgcggcgctactgggggtgggt
gcggtcgacgagccggacgtgcgggcgctgctggagcagctggtccccggcctgggcaac
gtcgtggtcctggacgcgctgggcctggcgccggtgacggcggacgtgacgttcctgcac
cacctgcaggggtcggcggtgctcaccccgaacctggcggagctggcgatcgtgctgggc
gccgagcccgaggaggtggaagccgacgtggcctcggcggccgtggagctggcccggcgc
agccggtgcgcggtcgccgcggggggcggggagtcgtggatcgcggcgcccgacggccgc
ctgtggcgggactcctccggcggggccgggctcggggtgtccgggtccggcgacgtcctg
tcggggatcgtcacggggttgtgcgcgcggggcgcggaccccgtccaggccgccgtgtgg
gcctgccacctgcacgggcgggccggtgaccggctggccagctcggtgggccggctgggc
ttcctggcccgcgagctgccggcccaggtgccggcggtgctcgcggagatcgaggtctag

DBGET integrated database retrieval system