KEGG   Kineococcus radiotolerans: Krad_3988Help
Entry
Krad_3988         CDS       T00562                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00020  Citrate cycle (TCA cycle)
kra00480  Glutathione metabolism
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
kra01120  Microbial metabolism in diverse environments
kra01130  Biosynthesis of antibiotics
kra01200  Carbon metabolism
kra01210  2-Oxocarboxylic acid metabolism
kra01230  Biosynthesis of amino acids
Module
kra_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kra_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Krad_3988
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Krad_3988
Enzymes [BR:kra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Krad_3988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: ABS05451
UniProt: A6WF62
LinkDB All DBs
Position
2899398..2900612
Genome map
AA seq 404 aa AA seqDB search
MAKIKVQGPVVELDGDEMTRIIWQFIKDRLVHPYLDVDLEYYDLGVEHRDATDDQVTIDA
AHAIQRAGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVIFREPIIISNIPRL
VPGWTKPIIVGRHAYGDQYRATDFKFPSAGTLTVTFTPEDGSEPIEHEVFQAPGAGVSLS
MYNLDASIVDFARSSLNYGLARNYPVYLSTKNTILKAYDGRFKDIFEEVFENEFKDRFAE
AGITYEHRLIDDMVAASLKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLSTPDGS
VVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIYAWTRGLAHRGKLDSTPEVTGFAETLED
VVIKTVESGKMTKDLALLVGPDQPWQTTEEFLGSLDDNLAARLA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtggccaagatcaaggtccagggaccggtcgtcgagctcgacggtgacgagatgacccgg
atcatctggcagttcatcaaggaccgcctggtccacccgtacctcgacgtcgacctggag
tactacgacctgggcgtcgagcaccgcgacgccaccgacgaccaggtgacgatcgacgcg
gcccacgccatccagcgggccggggtgggcgtcaagtgcgcgacgatcacgcccgacgag
gcgcgcgtcgaggagttcggcctcaagaagatgtggcgctcgcccaacgggacgatccgc
aacatcctcggcggcgtgatcttccgcgagccgatcatcatctccaacatcccgcgcctg
gtgccgggctggaccaagccgatcatcgtcggccgccacgcctacggcgaccagtaccgc
gcgaccgacttcaagttccccagcgcgggcaccctcacggtgaccttcacccccgaggac
ggctccgagcccatcgagcacgaggtcttccaggcccccggcgccggcgtctcgctgtcg
atgtacaacctcgacgcctcgatcgtcgacttcgcgcgctcctcgctcaactacggcctg
gcgcgcaactacccggtgtacctctccacgaagaacacgatcctcaaggcctacgacggc
cggttcaaggacatcttcgaggaggtcttcgagaacgagttcaaggacaggttcgccgag
gccgggatcacctacgagcaccgcctcatcgacgacatggtcgccgcgtccctgaagtgg
gagggcggctacgtctgggcctgcaagaactacgacggcgacgtccagtccgacaccgtc
gcgcagggcttcggctcgctggggctgatgacctcggtgctgtccaccccggacggctcc
gtggtggaggccgaggccgcccacggcaccgtgacccgccactaccgccagcaccagcag
ggcaagccgacgtcgacgaacccgatcgcgtcgatctacgcctggacccgcgggctggcc
caccgcggcaagctggactccacccccgaggtcaccggcttcgccgagaccctcgaggac
gtcgtcatcaagaccgtcgagagcggcaagatgaccaaggacctcgcgctgctcgtcggg
ccggaccagccctggcagaccaccgaggagttcctcggcagcctcgacgacaacctcgcc
gcgcgcctggcctga

DBGET integrated database retrieval system