KEGG   Kineococcus radiotolerans: Krad_4302Help
Entry
Krad_4302         CDS       T00562                                 

Definition
(GenBank) phospholipase D/Transphosphatidylase
  KO
K06131  cardiolipin synthase A/B [EC:2.7.8.-]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00564  Glycerophospholipid metabolism
kra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Krad_4302
Enzymes [BR:kra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     Krad_4302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLDc_2 PLDc PLDc_N Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: ABS05765
UniProt: A6WG26
LinkDB All DBs
Position
2575112..2576587
Genome map
AA seq 491 aa AA seqDB search
MDWLPDWAPSITAPALALLVVDLVVRLTAIAVVPVNRRPSSALAWLLAIFFIPYLGVLAF
LLIGNPKLPRARRRKQREINELILSSTKGMDLVSSDHPWPPWLSGVVELNRTLGSMPLVG
GNQARLEGEYDEAIRAMARTVDGAREYVHVEFYIMTRDPTSEPFFAALERAVERGVKVRL
LLDHLGSLRYPGYRRTIRSLDDMGVEWHPMLPVQLHRLKYQRPDLRNHRKLLVVDGEVAW
LGSQNVLDRSYNKRSNVRRGLQWQDLMVRLEGPVVAGVEAMFITDWYSETDELLQTERPE
VSPVGSPGRLECQVVPSGPGFDGENNLKLFNSLLYAAQRRISITSPYFVPDESMLSAITT
AAERGVDVELFVSEYGDQFFVHYAECSYYEDLLRAGVRIHRYPAPYVLHAKHMTIDDEVA
VIGSSNMDMRSFLLDLELTLMVCGREFADDLRRVEDEYRAKCTELTLEQWLARPRWQVIK
ENLSRLTSALQ
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggactggctgccggactgggctccctcgatcacggcgccggccctcgccctcctcgtc
gtggacctcgtggtgcgcctcaccgcgatcgcggtggtcccggtgaaccgccgccccagc
tccgccctcgcctggctgctggccatcttcttcatcccctacctgggggtgctggcgttc
ctgctcatcggcaaccccaagctgccccgcgcccggcggcgcaagcagcgggagatcaac
gagctcatcctgtcctccaccaagggcatggacctcgtctcctccgaccacccgtggccg
ccgtggctcagcggggtcgtggagctcaaccgcaccctcgggtcgatgccgctggtcggg
gggaaccaggcccgcctcgagggcgagtacgacgaggcgatccgcgcgatggcccgcacc
gtcgacggcgcccgcgagtacgtccacgtcgagttctacatcatgacccgggaccccacg
agcgaaccgttcttcgccgccctcgaacgggccgtcgagcgcggggtgaaggtccggctg
ctgctggaccacctggggtccctgcgctaccccggctaccggcgcacgatccgctccctc
gacgacatgggcgtggagtggcacccgatgctgcccgtgcagctgcaccggctgaagtac
cagcggccggacctgcgcaaccaccgcaagctcctcgtcgtcgacggggaggtcgcctgg
ctggggtcgcagaacgtgctggaccgcagctacaacaagcgctccaacgtgcggcgcggg
ctgcagtggcaggacctcatggtgcgcctggaggggccggtcgtcgccggcgtcgaggcc
atgttcatcaccgactggtactccgagaccgacgagctgctgcagaccgaacgccccgag
gtctccccggtcggctccccgggacggctggagtgccaggtcgtgcccagcggccccggg
ttcgacggggagaacaacctcaagctgttcaactccctgctgtacgccgcccagcggcgc
atctccatcaccagcccctacttcgtgcccgacgagtcgatgctgtcggccatcacgacg
gccgccgagcgcggggtcgacgtcgagctcttcgtctccgagtacggcgaccagttcttc
gtgcactacgccgagtgctcctactacgaggacctgctgcgggccggcgtgcggatccac
cgctaccccgcgccgtacgtcctgcacgccaagcacatgacgatcgacgacgaggtcgcc
gtcatcgggtcctccaacatggacatgcgctcgttcctgctggacctggagctgacgctc
atggtgtgcgggcgcgagttcgccgacgacctgcgccgggtcgaggacgagtaccgcgcg
aagtgcaccgagctcaccctggagcagtggctggcccgcccccggtggcaggtcatcaag
gagaacctctcccgcctcacctccgcgctgcagtag

DBGET integrated database retrieval system