KEGG   Kosakonia radicincitans: A3780_02660Help
Entry
A3780_02660       CDS       T04579                                 

Gene name
ilvH
Definition
(GenBank) acetolactate synthase small subunit
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
krd  Kosakonia radicincitans
Pathway
krd00290  Valine, leucine and isoleucine biosynthesis
krd00650  Butanoate metabolism
krd00660  C5-Branched dibasic acid metabolism
krd00770  Pantothenate and CoA biosynthesis
krd01100  Metabolic pathways
krd01110  Biosynthesis of secondary metabolites
krd01130  Biosynthesis of antibiotics
krd01210  2-Oxocarboxylic acid metabolism
krd01230  Biosynthesis of amino acids
Module
krd_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
krd_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:krd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A3780_02660 (ilvH)
   00660 C5-Branched dibasic acid metabolism
    A3780_02660 (ilvH)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    A3780_02660 (ilvH)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    A3780_02660 (ilvH)
Enzymes [BR:krd01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     A3780_02660 (ilvH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALS_ss_C ACT_5 ACT ACT_4 CompInhib_SCIN
Motif
Other DBs
NCBI-ProteinID: APG16515
UniProt: A0A5C1PIU7
LinkDB All DBs
Position
580018..580509
Genome map
AA seq 163 aa AA seqDB search
MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSRMTIQTVGDQKVLEQI
EKQLHKLVDVLRVNELGQGAYVEREIMLVKIQASGYGREEVKRNAEIFRGQIIDVTPSIY
TVQLAGTSDKLDAFLATIRDVAKIVEVARSGVVGLSRGDKIMR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcgccggatactgtctgtattactggaaaatgaatcgggcgcgttatcgcgcgtgatt
ggcctgttctctcagcgcggttacaacatagaaagcctgaccgttgcgccgactgacgat
cctaccttatcgcggatgacgatccagactgtcggcgatcaaaaagtgctggagcagatc
gaaaagcaactgcacaagctggtcgatgtgttacgcgtaaacgagctggggcagggggca
tatgttgagcgtgaaatcatgctggtgaagattcaggccagcggttacggtcgcgaagag
gtgaaacgcaacgctgagatcttccgcggacagatcattgacgttacgccatcgatttac
acggttcagctcgcaggcaccagtgacaagctggatgcgtttttagccaccattcgtgat
gtggcgaaaattgttgaagttgcgcgctccggtgtggtggggttgtcgcgcggcgataaa
atcatgcgctga

DBGET integrated database retrieval system