KEGG   Kosakonia radicincitans: A3780_03830
Entry
A3780_03830       CDS       T04579                                 

Definition
(GenBank) hypothetical protein
  KO
K03397  indoleacetate---lysine synthetase [EC:6.3.2.20]
Organism
krd  Kosakonia radicincitans
Brite
KEGG Orthology (KO) [BR:krd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A3780_03830
Enzymes [BR:krd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.20  indoleacetate---lysine synthetase
     A3780_03830
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-ProteinID: APG16726
LinkDB
Position
841510..842718
AA seq 402 aa
MDYCCAEMYAKMQPRITAITGCQAFDYTAFRDSVRMSSHVYSTTGDSGSLTQRDPAAEQI
PMLLGATSGTTGAMKMISVRLKSSKDAVSASEHNLIHNLRSRQVFSAGDVVGNLFTINLF
SSLHYSACEILKHCRAHVVPVGDIALLQKNHFDFLAEIQLSTLFGVPATLVQFVETMFRL
GVPLAIKKVVFTGEPMLAAHEKYLREVLGDDLRIIGLYGLSECGFIGMSVEGYHNKYLLF
SDDFFFEYDDKKGLLVTSLDPDASRKLVRYPVGDMGKLSVENNQLYFQGIKRNAIDFNFM
GNLISHEKIARMINQRLPEAIVQIVLSLSAERQEIMDIKICCGLSHASDLSGLENEICHL
PDIYEAYMKNRGRINLTVVEYNALLFSPRGKCLLVCDTRESC
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggattattgctgcgctgagatgtatgcaaaaatgcaaccgcggattacggcaatcacc
ggatgccaggcattcgattatacggccttccgtgattcagtcaggatgagttcccacgtt
tattcaaccactggcgacagtggttctttgacgcagcgggaccctgcggctgaacaaata
ccgatgctgcttggcgccacaagcggcaccaccggggcgatgaaaatgatcagcgtccgt
ttaaaatccagcaaggacgcggtcagcgcatcggagcacaatttaattcataacctgcgg
tcacggcaggttttttccgccggagacgtcgttggtaacctctttacgattaacctgttt
tcatccttacactattcggcgtgtgaaattttaaaacattgtcgcgcgcatgtggttccg
gtcggcgatattgcattgctgcagaagaatcatttcgattttctggccgaaattcagctc
tcgacgctgtttggtgtgccggccactctcgttcagtttgtggaaaccatgttccggctt
ggggttccgctggccattaaaaaagtggtctttaccggtgaaccgatgttggccgcgcat
gaaaagtatctgcgcgaggtactgggcgatgacctgcggataatcggtttgtacggcctg
tcggagtgcggtttcattgggatgtctgtcgaggggtatcataataaatatctgctgttc
agcgatgacttcttctttgaatatgacgataaaaaagggctattggtcacgtcgctggac
ccggatgcctcacgtaaacttgtcagatatccggtaggggatatgggcaaattatccgtt
gaaaataatcaactctattttcagggtattaaacgcaacgcgatagattttaatttcatg
ggcaatctgattagccatgaaaaaatagccagaatgattaatcaacgattgcctgaggcg
attgttcaaatcgtcttgtcgttatccgctgagagacaagaaatcatggatattaaaatc
tgctgcggattatctcatgcctctgatttgtccgggctggagaacgaaatctgtcatttg
ccggatatttatgaagcctatatgaaaaaccggggacgtatcaatctcaccgttgttgag
tataacgctctgcttttttcacccagagggaaatgtctgctggtttgcgacacaagggag
tcatgctaa

DBGET integrated database retrieval system